2DF6: SH3 Domain of betaPIX

Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide from PAK2. Determined by X-ray diffraction at 1.3 Å resolution. Released 11 Apr 2006.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Rattus norvegicus
Chains: 4
Atoms: 1,336
Mol. weight: 17.57 kDa
Released: 11 Apr 2006

Explore 2DF6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DF6 contains 6 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	10-13	4	1
β-strand	17	1	2
β-strand	24	1	1
β-strand	27	1	2
β-strand	32-38	7	1
β-strand	43-48	6	1
β-strand	51-56	6	1
α-helix	57-59	3
β-strand	60-62	3	1

Chain B: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	10-13	4	3
β-strand	17	1	4
β-strand	24	1	3
β-strand	27	1	4
β-strand	32-37	6	3
β-strand	43-48	6	3
β-strand	51-56	6	3
α-helix	57-59	3
β-strand	60-62	3	3

Chains C and D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	181-187	7
α-helix	188-190	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rho guanine nucleotide exchange factor 7	A, B	protein	59	Rattus norvegicus	O55043 (AlphaFold model)
18-mer from PAK2	C, D	protein	18		Q64303 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2DF6_1 Rho guanine nucleotide exchange factor 7 (chains A, B)
GPLGSVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI

Sequence of entity 2 (C, D), FASTA

>2DF6_2 18-mer from PAK2 (chains C, D)
PPVIAPRPEHTKSIYTRS

Primary citation

Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide from PAK2. Hoelz, A., Janz, J.M., Lawrie, S.D. et al. J Mol Biol (2006) 358:509-522. DOI 10.1016/j.jmb.2006.02.027 · PubMed

Other PDB entries of the same protein (UniProt O55043 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2G6F 0.92 Å, Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide…
2AK5 1.85 Å, beta PIX-SH3 complexed with a Cbl-b peptide
2P4R 2.0 Å, Structural basis for a novel interaction between AIP4 and beta-PIX
3QJN 2.71 Å, Structural flexibility of Shank PDZ domain is important for its binding to different…
2W6B 2.8 Å, Crystal Structure of the Trimeric beta-PIX Coiled-Coil Domain
3L4F 2.8 Å, Crystal Structure of betaPIX Coiled-Coil Domain and Shank PDZ Complex

Browse structure collections

About this viewer

MolViewer shows 2DF6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.