2AST: Skp1-Skp2-Cks1

Crystal structure of Skp1-Skp2-Cks1 in complex with a p27 peptide. Determined by X-ray diffraction at 2.3 Å resolution. Released 18 Oct 2005.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,660
Mol. weight: 65.91 kDa
Ligands: BEN
Released: 18 Oct 2005

Explore 2AST in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AST contains 30 α-helices and 29 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	1003-1007	5	1
β-strand	1013-1017	5	1
α-helix	1018-1022	5
α-helix	1025-1030	6
α-helix	1037-1038	8
β-strand	1039-1040	2	1
α-helix	1046-1058	13
α-helix	1087-1092	6
α-helix	1097-1110	14
α-helix	1113-1127	15
α-helix	1132-1138	7
α-helix	1149-1156	8

Chain B: 15 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	2102-2109	8
α-helix	2114-2119	6
α-helix	2125-2131	7
β-strand	2139-2141	3	2
β-strand	2146	1	3
α-helix	2149-2157	9
β-strand	2162-2164	3	2
β-strand	2169-2170	2	3
α-helix	2179-2180	2
β-strand	2181	1	4
β-strand	2185-2187	3	2
β-strand	2192-2193	2	3
α-helix	2195-2202	8
β-strand	2205	1	4
β-strand	2210-2212	3	2
β-strand	2217	1	5
α-helix	2220-2226	7
β-strand	2234-2236	3	2
β-strand	2241	1	5
α-helix	2245-2254	10
β-strand	2260-2262	3	2
α-helix	2271-2280	10
β-strand	2287-2289	3	2
α-helix	2294-2296	3
α-helix	2299-2308	10
β-strand	2314-2316	3	2
α-helix	2325-2333	9
β-strand	2339-2341	3	2
α-helix	2350-2358	9
β-strand	2364-2366	3	2
α-helix	2376-2382	7
β-strand	2387-2388	2	2
β-strand	2409	1	6
β-strand	2412	1	6
α-helix	2413-2414	2
β-strand	2416-2417	2	2

Chain C: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	3007-3008	2	7
α-helix	3009-3011	3
β-strand	3012-3013	2	7
β-strand	3017-3023	7	7
α-helix	3024-3025	2
α-helix	3026-3029	4
α-helix	3037-3039	3
α-helix	3040-3046	7
β-strand	3055-3059	5	7
β-strand	3066-3072	7	7

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4187-4189	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
S-phase kinase-associated protein 1A	A	protein	159	Homo sapiens	P63208 (AlphaFold model)
S-phase kinase-associated protein 2	B	protein	336	Homo sapiens	Q13309 (AlphaFold model)
Cyclin-dependent kinases regulatory subunit 1	C	protein	69	Homo sapiens	P61024 (AlphaFold model)
Cyclin-dependent kinase inhibitor 1B	D	protein	10		P46527 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2AST_1 S-phase kinase-associated protein 1A (chains A)
ASIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQW
CTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCK
TVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWC

Sequence of entity 2 (B), FASTA

>2AST_2 S-phase kinase-associated protein 2 (chains B)
RENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLH
PDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKL
QNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFD
FTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCF
QEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQI
NCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL

Sequence of entity 3 (C), FASTA

>2AST_3 Cyclin-dependent kinases regulatory subunit 1 (chains C)
QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEP
HILLFRRPL

Sequence of entity 4 (D), FASTA

>2AST_4 Cyclin-dependent kinase inhibitor 1B (chains D)
AGSVEQTPKK

Ligands and cofactors

ID	Name	Formula	Copies
BEN	Benzamidine	C7 H8 N2	2

Primary citation

Structural Basis of the Cks1-Dependent Recognition of p27(Kip1) by the SCF(Skp2) Ubiquitin Ligase. Hao, B., Zheng, N., Schulman, B.A. et al. Mol Cell (2005) 20:9-19. DOI 10.1016/j.molcel.2005.09.003 · PubMed

Other PDB entries of the same protein (UniProt P63208 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FS1 1.8 Å, Insights into scf ubiquitin ligases from the structure of the SKP1-SKP2 complex
6M90 2.05 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2776 ternary complex
6M92 2.35 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2663 ternary complex
2E31 2.4 Å, Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase
6M91 2.4 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-103094 ternary complex
2OVR 2.5 Å, Structure of the Skp1-Fbw7-CyclinEdegN complex
6M93 2.5 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-1933 ternary complex
6WNX 2.5 Å, FBXW11-SKP1 in complex with a pSer33/pSer37 Beta-Catenin peptide
5IBK 2.5 Å, Skp1-F-box in complex with a ubiquitin variant
6O60 2.5 Å, Crystal structure of GGTase3-FBXL2-SKP1 complex
5JH5 2.55 Å, Structural Basis for the Hierarchical Assembly of the Core of PRC1.1
7T1Y 2.55 Å, Structure of the Fbw7-Skp1-MycCdegron complex

Browse structure collections

About this viewer

MolViewer shows 2AST directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.