Synapse associated protein 97 PDZ2 domain variant C378G with C-terminal GluR-A peptide. Determined by X-ray diffraction at 2.21 Å resolution. Released 29 Aug 2006.
Explore 2AWW in 3D Show helices and sheets RCSB PDB PDBe
2AWW contains 4 α-helices and 19 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 319-323 | 5 | 1 |
| β-strand | 325 | 1 | 2 |
| β-strand | 328 | 1 | 2 |
| β-strand | 331-335 | 5 | 1 |
| β-strand | 342 | 1 | 3 |
| β-strand | 345 | 1 | 3 |
| β-strand | 348-353 | 6 | 1 |
| α-helix | 358-362 | 5 | |
| α-helix | 369 | 1 | |
| β-strand | 370-374 | 5 | 1 |
| β-strand | 377-378 | 2 | 1 |
| α-helix | 384-392 | 9 | |
| β-strand | 397-403 | 7 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 316-323 | 8 | 4 |
| β-strand | 332-335 | 4 | 4 |
| β-strand | 342 | 1 | 5 |
| β-strand | 345 | 1 | 5 |
| β-strand | 348-352 | 5 | 4 |
| α-helix | 358-361 | 4 | |
| β-strand | 370-374 | 5 | 4 |
| β-strand | 377-378 | 2 | 4 |
| β-strand | 397-404 | 8 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 16-17 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Synapse associated protein 97 | A, B | protein | 105 | Rattus norvegicus | Q62696 (AlphaFold model) |
| 18-residue C-terminal peptide from glutamate receptor, ionotropic, AMPA1 | C | protein | 18 | P19490 (AlphaFold model) |
>2AWW_1 Synapse associated protein 97 (chains A, B) MEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTSIVEGGAAHKDGKLQIGDKLLA VNSVGLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYISRHHHHHH
>2AWW_2 18-residue C-terminal peptide from glutamate receptor, ionotropic, AMPA1 (chains C) SIPCMSHSSGMPLGATGL
Crystal structure of the second PDZ domain of SAP97 in complex with a GluR-A C-terminal peptide. von Ossowski, I., Oksanen, E., von Ossowski, L. et al. FEBS J (2006) 273:5219-5229. DOI 10.1111/j.1742-4658.2006.05521.x · PubMed
Other PDB entries of the same protein (UniProt Q62696 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2AWW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.