2B19: Mammalian tachykinin peptide, Neuropeptide K
Solution Structure of mammalian tachykinin peptide, Neuropeptide K. Determined by solution NMR. Released 19 Sept 2006.
- Method
- Solution NMR
- Chains
- 1
- Atoms
- 279
- Mol. weight
- 3.99 kDa
- Released
- 19 Sept 2006
Explore 2B19 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
2B19 contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 6 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-9 | 8 | |
| α-helix | 10-17 | 8 | |
| α-helix | 18-20 | 3 | |
| α-helix | 21-24 | 4 | |
| α-helix | 27-30 | 4 | |
| α-helix | 31-35 | 5 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Neuropeptide K | A | protein | 36 | | P20366 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>2B19_1 Neuropeptide K (chains A)
DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM
Primary citation
Three-dimensional structure of neuropeptide k bound to dodecylphosphocholine micelles. Dike, A., Cowsik, S.M. Biochemistry (2006) 45:2994-3004. DOI 10.1021/bi052287o · PubMed
Other PDB entries of the same protein (UniProt P20366 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4HOM 1.9 Å, Crystal structure of porcine aminopeptidase-N complexed with substance P
- 8U26 2.5 Å, Gaussian Mixture Models based single particle refinement - GPCR (Substance P bound to…
- 7XWO 2.7 Å, Neurokinin A bound to active human neurokinin 2 receptor in complex with G324
- 7P00 2.71 Å, Human Neurokinin 1 receptor (NK1R) substance P Gq chimera (mGsqi) complex
- 7P02 2.87 Å, Human Neurokinin 1 receptor (NK1R) substance P Gs complex
- 8JBH 2.9 Å, Substance P bound to active human neurokinin 3 receptor in complex with Gq
- 9W1J 2.97 Å, Cryo-EM structure of neurokinin A (NKA)-bound neurokinin 2 receptor (NK2R) in complex…
- 7VDM 2.98 Å, Cryo-EM structure of pseudoallergen receptor MRGPRX2 complex with substance P
- 7RMG 3.0 Å, Substance P bound to active human neurokinin 1 receptor in complex with miniGs/q70
- 7RMH 3.1 Å, Substance P bound to active human neurokinin 1 receptor in complex with miniGs399
- 2KS9 Solution conformation of substance P in water complexed with NK1R
- 2KSA Substance P in DMPC/CHAPS isotropic q=0.25 bicelles as a ligand for NK1R
Browse structure collections
About this viewer
MolViewer shows 2B19 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.