2B49: PDB entry 2B49

Crystal Structure of the Catalytic Domain of Protein Tyrosine Phosphatase, non-receptor Type 3. Determined by X-ray diffraction at 1.54 Å resolution. Released 4 Oct 2005.

Method: X-ray diffraction
Resolution: 1.54 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,380
Mol. weight: 32.75 kDa
Released: 4 Oct 2005

Explore 2B49 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2B49 contains 13 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	649-652	4
α-helix	664-666	3
α-helix	668-673	6
β-strand	686-688	3	1
α-helix	689	1
β-strand	695-705	11	1
α-helix	706-708	3
β-strand	710-717	8	1
α-helix	718-721	4
α-helix	725-734	10
β-strand	739-742	4	1
β-strand	747-748	2	2
β-strand	751-752	2	2
α-helix	759-760	2
β-strand	764-767	4	1
β-strand	770-779	10	1
β-strand	783-792	10	1
β-strand	798-806	9	1
α-helix	819-831	13
α-helix	837	1
β-strand	838-841	4	1
α-helix	847-863	17
α-helix	870-878	9
α-helix	888-903	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
protein tyrosine phosphatase, non-receptor type 3	A	protein	287	Homo sapiens	P26045 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2B49_1 protein tyrosine phosphatase, non-receptor type 3 (chains A)
MDTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGLAITFAKLPQNLDKNRYKDVLPYDTTR
VLLQGNEDYINASYVNMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLIVMLTTL
TERGRTKCHQYWPDPPDVMNHGGFHIQCQSEDCTIAYVSREMLVTNTQTGEEHTVTHLQY
VAWPDHGVPDDSSDFLEFVNYVRSLRVDSEPVLVHCSAGIGRTGVLVTMETAMCLTERNL
PIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQMLDPS

Primary citation

Large-scale structural analysis of the classical human protein tyrosine phosphatome. Barr, A.J., Ugochukwu, E., Lee, W.H. et al. Cell (2009) 136:352-363. DOI 10.1016/j.cell.2008.11.038 · PubMed

Other PDB entries of the same protein (UniProt P26045 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4RI5 1.26 Å, Crystal structure of PTPN3 (PTPH1) D811E mutant in complex with metavanadate
4RHG 1.58 Å, Crystal structure of PTPN3 (PTPH1) D811E, C842S mutant in complex with Eps15 pTyr849…
4RI4 1.6 Å, Crystal structure of PTPN3 (PTPH1) Y676I mutant in complex with vanadate
4RH9 1.6 Å, Crystal structure of PTPN3 (PTPH1) H812F, M883G mutant in complex with Eps15 pTyr849…
4RH5 1.6 Å, Crystal structure of PTPN3 (PTPH1) in complex with Eps15 pTyr849 peptide
8CQY 1.7 Å, Crystal structure of the PTPN3 PDZ domain bound to the PBM TACE C-terminal peptide
4S0G 1.72 Å, Crystal structure of PTPN3 (PTPH1) in complex with Eps15 pTyr849 P850V peptide
4QUN 1.86 Å, Crystal structure of the PTPN3 (PTPH1) catalytic domain C842S mutant
6T36 1.86 Å, Crystal structure of the PTPN3 PDZ domain bound to the HBV core protein C-terminal peptide
8OEP 1.87 Å, Crystal structure of the PTPN3 PDZ domain bound to the HPV18 E6 oncoprotein C-terminal…
6HKS 2.19 Å, Crystal structure of the PTPN3 PDZ domain bound to the HPV16 E6 oncoprotein C-terminal…
4QUM 2.52 Å, Crystal structure of PTPN3 (PTPH1) in complex with a dually phosphorylated MAPK12 peptide

Browse structure collections

About this viewer

MolViewer shows 2B49 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.