4QUN: PTPN3 (PTPH1) catalytic domain C842S mutant

Crystal structure of the PTPN3 (PTPH1) catalytic domain C842S mutant. Determined by X-ray diffraction at 1.86 Å resolution. Released 10 Dec 2014.

Method: X-ray diffraction
Resolution: 1.86 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,951
Mol. weight: 70.15 kDa
Ligands: PO4
Released: 10 Dec 2014

Explore 4QUN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4QUN contains 31 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	630-643	14
α-helix	645-652	8
α-helix	664-666	3
α-helix	671-673	3
β-strand	686-688	3	1
α-helix	689	1
β-strand	695-705	11	1
α-helix	706-708	3
β-strand	710-717	8	1
α-helix	718-721	4
α-helix	722-724	3
α-helix	725-735	11
β-strand	739-742	4	1
β-strand	747-748	2	2
β-strand	751-752	2	2
α-helix	759-760	2
β-strand	764-767	4	1
β-strand	770-779	10	1
β-strand	783-792	10	1
β-strand	798-806	9	1
α-helix	818-831	14
α-helix	837	1
β-strand	838-841	4	1
α-helix	847-863	17
α-helix	870-878	9
α-helix	888-907	20

Chain B: 16 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	630-643	14
α-helix	645-652	8
α-helix	664-666	3
α-helix	668-673	6
β-strand	686-688	3	3
α-helix	689	1
β-strand	695-705	11	3
α-helix	706-708	3
β-strand	710-717	8	3
α-helix	718-721	4
α-helix	722-724	3
α-helix	725-734	10
β-strand	739-742	4	3
β-strand	747-748	2	4
β-strand	751-752	2	4
α-helix	759-760	2
β-strand	764-767	4	3
β-strand	770-779	10	3
β-strand	783-792	10	3
β-strand	798-806	9	3
α-helix	818-831	14
α-helix	832-833	2
α-helix	837	1
β-strand	838-841	4	3
α-helix	847-862	16
α-helix	870-878	9
α-helix	888-907	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 3	A, B	protein	306	Homo sapiens	P26045 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4QUN_1 Tyrosine-protein phosphatase non-receptor type 3 (chains A, B)
MHHHHHHSSGVDLGTENLYFQSNADTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGLAIT
FAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGPLPH
TCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGFHIQCQSEDCTIAY
VSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDSEPVLVHSS
AGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYE
EGLVQM

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Reciprocal allosteric regulation of p38 gamma and PTPN3 involves a PDZ domain-modulated complex formation. Chen, K.E., Lin, S.Y., Wu, M.J. et al. Sci Signal (2014) 7:ra98-ra98. DOI 10.1126/scisignal.2005722 · PubMed

Other PDB entries of the same protein (UniProt P26045 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4RI5 1.26 Å, Crystal structure of PTPN3 (PTPH1) D811E mutant in complex with metavanadate
2B49 1.54 Å, Crystal Structure of the Catalytic Domain of Protein Tyrosine Phosphatase, non-receptor…
4RHG 1.58 Å, Crystal structure of PTPN3 (PTPH1) D811E, C842S mutant in complex with Eps15 pTyr849…
4RI4 1.6 Å, Crystal structure of PTPN3 (PTPH1) Y676I mutant in complex with vanadate
4RH9 1.6 Å, Crystal structure of PTPN3 (PTPH1) H812F, M883G mutant in complex with Eps15 pTyr849…
4RH5 1.6 Å, Crystal structure of PTPN3 (PTPH1) in complex with Eps15 pTyr849 peptide
8CQY 1.7 Å, Crystal structure of the PTPN3 PDZ domain bound to the PBM TACE C-terminal peptide
4S0G 1.72 Å, Crystal structure of PTPN3 (PTPH1) in complex with Eps15 pTyr849 P850V peptide
6T36 1.86 Å, Crystal structure of the PTPN3 PDZ domain bound to the HBV core protein C-terminal peptide
8OEP 1.87 Å, Crystal structure of the PTPN3 PDZ domain bound to the HPV18 E6 oncoprotein C-terminal…
6HKS 2.19 Å, Crystal structure of the PTPN3 PDZ domain bound to the HPV16 E6 oncoprotein C-terminal…
4QUM 2.52 Å, Crystal structure of PTPN3 (PTPH1) in complex with a dually phosphorylated MAPK12 peptide

Browse structure collections

About this viewer

MolViewer shows 4QUN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.