6HKS: PTPN3 PDZ domain
Crystal structure of the PTPN3 PDZ domain bound to the HPV16 E6 oncoprotein C-terminal peptide. Determined by X-ray diffraction at 2.19 Å resolution. Released 22 May 2019.
- Method
- X-ray diffraction
- Resolution
- 2.19 Å
- Organisms
- Homo sapiens, Human papillomavirus type 16
- Chains
- 12
- Atoms
- 4,993
- Mol. weight
- 85.38 kDa
- Released
- 22 May 2019
Explore 6HKS in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6HKS contains 28 α-helices and 42 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 3 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 507-513 | 7 | 1 |
| β-strand | 523-528 | 6 | 1 |
| β-strand | 533-540 | 8 | 1 |
| α-helix | 545-548 | 4 | |
| α-helix | 557 | 1 | |
| β-strand | 558-562 | 5 | 1 |
| β-strand | 565-566 | 2 | 1 |
| α-helix | 572-581 | 10 | |
| β-strand | 590-596 | 7 | 1 |
Chains B and F: 5 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 507-513 | 7 | 2 |
| β-strand | 523-528 | 6 | 2 |
| β-strand | 533-540 | 8 | 2 |
| α-helix | 545-548 | 4 | |
| α-helix | 552-553 | 2 | |
| α-helix | 557 | 1 | |
| β-strand | 558-562 | 5 | 2 |
| β-strand | 565-566 | 2 | 2 |
| α-helix | 572-581 | 10 | |
| α-helix | 582-584 | 3 | |
| β-strand | 590-596 | 7 | 2 |
Chain C: 5 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 508-513 | 6 | 3 |
| β-strand | 523-528 | 6 | 3 |
| β-strand | 533-540 | 8 | 3 |
| α-helix | 545-548 | 4 | |
| α-helix | 552-553 | 2 | |
| α-helix | 557 | 1 | |
| β-strand | 558-562 | 5 | 3 |
| β-strand | 565-566 | 2 | 3 |
| α-helix | 572-581 | 10 | |
| α-helix | 582-584 | 3 | |
| β-strand | 590-595 | 6 | 3 |
Chain D: 5 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 508-513 | 6 | 4 |
| β-strand | 523-528 | 6 | 4 |
| α-helix | 529-531 | 3 | |
| β-strand | 533-540 | 8 | 4 |
| α-helix | 545-548 | 4 | |
| α-helix | 557 | 1 | |
| β-strand | 558-562 | 5 | 4 |
| β-strand | 565-566 | 2 | 4 |
| α-helix | 572-581 | 10 | |
| α-helix | 582-584 | 3 | |
| β-strand | 590-595 | 6 | 4 |
Chain E: 5 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 507-513 | 7 | 5 |
| β-strand | 523-528 | 6 | 5 |
| α-helix | 529-531 | 3 | |
| β-strand | 533-540 | 8 | 5 |
| α-helix | 545-548 | 4 | |
| α-helix | 557 | 1 | |
| β-strand | 558-562 | 5 | 5 |
| β-strand | 565-566 | 2 | 5 |
| α-helix | 572-581 | 10 | |
| α-helix | 582-584 | 3 | |
| β-strand | 590-596 | 7 | 5 |
Chains G, H, I, J, K and L: 0 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-6 | 3 | 1 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Tyrosine-protein phosphatase non-receptor type 3 | A, B, C, D, E, F | protein | 114 | Homo sapiens | P26045 (AlphaFold model) |
| Protein E6 | G, H, I, J, K, L | protein | 11 | Human papillomavirus type 16 | P03126 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F), FASTA
>6HKS_1 Tyrosine-protein phosphatase non-receptor type 3 (chains A, B, C, D, E, F)
GAMGSSTEDASQYYCDKNDNGDSYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRINPE
SPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRR
Sequence of entity 2 (G, H, I, J, K, L), FASTA
>6HKS_2 Protein E6 (chains G, H, I, J, K, L)
RSSRTRRETQL
Primary citation
Structural and functional characterization of the PDZ domain of the human phosphatase PTPN3 and its interaction with the human papillomavirus E6 oncoprotein. Genera, M., Samson, D., Raynal, B. et al. Sci Rep (2019) 9:7438-7438. DOI 10.1038/s41598-019-43932-x · PubMed
Other PDB entries of the same protein (UniProt P26045 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4RI5 1.26 Å, Crystal structure of PTPN3 (PTPH1) D811E mutant in complex with metavanadate
- 2B49 1.54 Å, Crystal Structure of the Catalytic Domain of Protein Tyrosine Phosphatase, non-receptor…
- 4RHG 1.58 Å, Crystal structure of PTPN3 (PTPH1) D811E, C842S mutant in complex with Eps15 pTyr849…
- 4RI4 1.6 Å, Crystal structure of PTPN3 (PTPH1) Y676I mutant in complex with vanadate
- 4RH9 1.6 Å, Crystal structure of PTPN3 (PTPH1) H812F, M883G mutant in complex with Eps15 pTyr849…
- 4RH5 1.6 Å, Crystal structure of PTPN3 (PTPH1) in complex with Eps15 pTyr849 peptide
- 8CQY 1.7 Å, Crystal structure of the PTPN3 PDZ domain bound to the PBM TACE C-terminal peptide
- 4S0G 1.72 Å, Crystal structure of PTPN3 (PTPH1) in complex with Eps15 pTyr849 P850V peptide
- 4QUN 1.86 Å, Crystal structure of the PTPN3 (PTPH1) catalytic domain C842S mutant
- 6T36 1.86 Å, Crystal structure of the PTPN3 PDZ domain bound to the HBV core protein C-terminal peptide
- 8OEP 1.87 Å, Crystal structure of the PTPN3 PDZ domain bound to the HPV18 E6 oncoprotein C-terminal…
- 4QUM 2.52 Å, Crystal structure of PTPN3 (PTPH1) in complex with a dually phosphorylated MAPK12 peptide
Browse structure collections
About this viewer
MolViewer shows 6HKS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.