Crystal structure of PTPN3 (PTPH1) D811E mutant in complex with metavanadate. Determined by X-ray diffraction at 1.26 Å resolution. Released 11 Mar 2015.
Explore 4RI5 in 3D Show helices and sheets RCSB PDB PDBe
4RI5 contains 29 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 630-643 | 14 | |
| α-helix | 645-652 | 8 | |
| α-helix | 664-666 | 3 | |
| α-helix | 668-673 | 6 | |
| β-strand | 686-688 | 3 | 1 |
| α-helix | 689 | 1 | |
| β-strand | 695-705 | 11 | 1 |
| β-strand | 710-717 | 8 | 1 |
| α-helix | 718-721 | 4 | |
| α-helix | 722-724 | 3 | |
| α-helix | 725-734 | 10 | |
| β-strand | 739-742 | 4 | 1 |
| β-strand | 747-748 | 2 | 2 |
| β-strand | 751-752 | 2 | 2 |
| α-helix | 759-760 | 2 | |
| β-strand | 764-767 | 4 | 1 |
| β-strand | 770-779 | 10 | 1 |
| β-strand | 783-792 | 10 | 1 |
| β-strand | 798-806 | 9 | 1 |
| α-helix | 818-831 | 14 | |
| α-helix | 837 | 1 | |
| β-strand | 838-841 | 4 | 1 |
| α-helix | 847-863 | 17 | |
| α-helix | 870-878 | 9 | |
| α-helix | 888-907 | 20 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 630-643 | 14 | |
| α-helix | 645-652 | 8 | |
| α-helix | 664-666 | 3 | |
| α-helix | 668-673 | 6 | |
| β-strand | 686-688 | 3 | 3 |
| α-helix | 689 | 1 | |
| β-strand | 695-705 | 11 | 3 |
| α-helix | 706-708 | 3 | |
| β-strand | 710-717 | 8 | 3 |
| α-helix | 718-721 | 4 | |
| α-helix | 722-724 | 3 | |
| α-helix | 725-734 | 10 | |
| β-strand | 739-742 | 4 | 3 |
| β-strand | 747-748 | 2 | 4 |
| β-strand | 751-752 | 2 | 4 |
| α-helix | 759-760 | 2 | |
| β-strand | 764-767 | 4 | 3 |
| β-strand | 770-779 | 10 | 3 |
| β-strand | 783-792 | 10 | 3 |
| β-strand | 798-806 | 9 | 3 |
| α-helix | 818-831 | 14 | |
| α-helix | 837 | 1 | |
| β-strand | 838-841 | 4 | 3 |
| α-helix | 847-863 | 17 | |
| α-helix | 870-878 | 9 | |
| α-helix | 888-905 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tyrosine-protein phosphatase non-receptor type 3 | A, B | protein | 306 | Homo sapiens | P26045 (AlphaFold model) |
>4RI5_1 Tyrosine-protein phosphatase non-receptor type 3 (chains A, B) MHHHHHHSSGVDLGTENLYFQSNADTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGLAIT FAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGPLPH TCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGFHIQCQSEDCTIAY VSREMLVTNTQTGEEHTVTHLQYVAWPEHGVPDDSSDFLEFVNYVRSLRVDSEPVLVHCS AGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYE EGLVQM
| ID | Name | Formula | Copies |
|---|---|---|---|
| VN4 | oxido(dioxo)vanadium | O3 V | 2 |
Water and common crystallization additives (GOL) are not listed.
Substrate specificity and plasticity of FERM-containing protein tyrosine phosphatases. Chen, K.E., Li, M.Y., Chou, C.C. et al. Structure (2015) 23:653-664. DOI 10.1016/j.str.2015.01.017 · PubMed
Other PDB entries of the same protein (UniProt P26045 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4RI5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.