2BHL: Human glucose-6-phosphate dehydrogenase

X-ray structure of human glucose-6-phosphate dehydrogenase (deletion variant) complexed with glucose-6-phosphate. Determined by X-ray diffraction at 2.9 Å resolution. Released 25 Apr 2005.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 7,903
Mol. weight: 113.87 kDa
Ligands: BG6
Released: 25 Apr 2005

Explore 2BHL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BHL contains 57 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 30 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	32-37	6	1
α-helix	42-43	2
α-helix	44-48	5
α-helix	49-57	9
β-strand	65-71	7	1
α-helix	77-84	8
α-helix	85-87	3
α-helix	92-94	3
α-helix	97-102	6
β-strand	105-109	5	1
α-helix	115-127	13
α-helix	131-133	3
β-strand	135-140	6	1
α-helix	147-156	10
β-strand	165-169	5	1
α-helix	177-190	14
β-strand	196-198	3	1
α-helix	201-204	4
α-helix	206-216	11
β-strand	230-239	10	2
α-helix	250-253	4
α-helix	255	1
α-helix	256-264	9
α-helix	265-272	8
α-helix	273-276	4
α-helix	281-292	12
β-strand	295	1	3
α-helix	296-298	3
α-helix	300-302	3
β-strand	303-309	7	2
α-helix	317-319	3
α-helix	329	1
β-strand	337-343	7	2
β-strand	344	1	3
β-strand	353-360	8	2
β-strand	366-373	8	2
α-helix	374-376	3
β-strand	389-395	7	2
β-strand	399-407	9	2
β-strand	415-423	9	2
α-helix	424-427	4
α-helix	433-435	3
α-helix	436-446	11
β-strand	453	1	1
α-helix	455-475	21
α-helix	479	1
β-strand	480-483	4	2
α-helix	490-499	10

Chain B: 27 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	32-37	6	4
α-helix	42-43	2
α-helix	44-48	5
α-helix	49-57	9
β-strand	65-71	7	4
α-helix	77-84	8
α-helix	85-87	3
α-helix	92-94	3
α-helix	95-103	9
β-strand	105-109	5	4
α-helix	115-127	13
β-strand	135-140	6	4
α-helix	144-156	13
β-strand	165-169	5	4
α-helix	177-190	14
α-helix	193-195	3
β-strand	196-198	3	4
α-helix	201-204	4
α-helix	206-216	11
β-strand	230-238	9	2
α-helix	247-251	5
α-helix	256-264	9
α-helix	265-272	8
α-helix	273-276	4
α-helix	281-292	12
β-strand	295	1	5
α-helix	296-299	4
β-strand	303-309	7	2
α-helix	316-319	4
β-strand	337-343	7	2
β-strand	344	1	5
β-strand	353-359	7	2
β-strand	362	1	6
β-strand	366-373	8	2
α-helix	374-376	3
β-strand	389-395	7	2
β-strand	399-407	9	2
β-strand	415-423	9	2
α-helix	424-427	4
α-helix	432-435	4
α-helix	436-446	11
β-strand	453	1	4
α-helix	455-474	20
α-helix	479	1
β-strand	480-483	4	2
β-strand	486	1	6
α-helix	490-499	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glucose-6-phosphate 1-dehydrogenase	A, B	protein	489	HOMO SAPIENS	P11413 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2BHL_1 GLUCOSE-6-PHOSPHATE 1-DEHYDROGENASE (chains A, B)
VQSDTHIFIIMGASGDLAKKKIYPTIWWLFRDGLLPENTFIVGYARSRLTVADIRKQSEP
FFKATPEEKLKLEDFFARNSYVAGQYDDAASYQRLNSHMNALHLGSQANRLFYLALPPTV
YEAVTKNIHESCMSQIGWNRIIVEKPFGRDLQSSDRLSNHISSLFREDQIYRIDHYLGKE
MVQNLMVLRFANRIFGPIWNRDNIACVILTFKEPFGTEGRGGYFDEFGIIRDVMQNHLLQ
MLCLVAMEKPASTNSDDVRDEKVKVLKCISEVQANNVVLGQYVGNPDGEGEATKGYLDDP
TVPRGSTTATFAAVVLYVENERWDGVPFILRCGKALNERKAEVRLQFHDVAGDIFHQQCK
RNELVIRVQPNEAVYTKMMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFC
GSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVGFQYEGT
YKWVNPHKL

Ligands and cofactors

ID	Name	Formula	Copies
BG6	6-O-phosphono-beta-D-glucopyranose	C6 H13 O9 P	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structural Studies of Glucose-6-Phosphate and Nadp+ Binding to Human Glucose-6-Phosphate Dehydrogenase. Kotaka, M., Gover, S., Vandeputte-Rutten, L. et al. Acta Crystallogr D Biol Crystallogr (2005) 61:495. DOI 10.1107/S0907444905002350 · PubMed

Other PDB entries of the same protein (UniProt P11413 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JYU 1.89 Å, Crystal structure of Human G6PD Canton
6E08 1.9 Å, Crystal structure of G6PD in complex with structural NADP
7SNH 2.2 Å, Structure of G6PD-D200N tetramer bound to NADP+
7ZVE 2.28 Å, K403 acetylated glucose-6-phosphate dehydrogenase (G6PD)
7ZVD 2.46 Å, K89 acetylated glucose-6-phosphate dehydrogenase (G6PD) in a complex with structural NADP+
2BH9 2.5 Å, X-ray structure of a deletion variant of human glucose 6-phosphate dehydrogenase…
7SNI 2.5 Å, Structure of G6PD-D200N tetramer bound to NADP+ and G6P
7UC2 2.5 Å, Structure of G6PD-D200N tetramer bound to NADP+ with no symmetry applied
6E07 2.6 Å, Crystal structure of Canton G6PD in complex with structural NADP
5UKW 2.65 Å, Crystal structure of human Glucose 6-phosphate Dehydrogenase mutant (A277C) complexed…
7SNG 2.8 Å, structure of G6PD-WT tetramer
7SEH 2.9 Å, Glucose-6-phosphate 1-dehydrogenase (K403QdLtL)

Browse structure collections

About this viewer

MolViewer shows 2BHL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.