Glucose-6-phosphate 1-dehydrogenase (K403QdLtL). Determined by X-ray diffraction at 2.9 Å resolution. Released 17 Aug 2022.
Explore 7SEH in 3D Show helices and sheets RCSB PDB PDBe
7SEH contains 55 α-helices and 33 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 31-37 | 7 | 1 |
| α-helix | 42-43 | 2 | |
| α-helix | 44-48 | 5 | |
| α-helix | 49-57 | 9 | |
| β-strand | 64-71 | 8 | 1 |
| α-helix | 77-84 | 8 | |
| α-helix | 92-94 | 3 | |
| α-helix | 95-104 | 10 | |
| β-strand | 105-109 | 5 | 1 |
| α-helix | 115-126 | 12 | |
| α-helix | 131-133 | 3 | |
| β-strand | 135-140 | 6 | 1 |
| α-helix | 147-153 | 7 | |
| α-helix | 154-158 | 5 | |
| β-strand | 165-169 | 5 | 1 |
| α-helix | 170 | 1 | |
| α-helix | 172 | 1 | |
| α-helix | 177-187 | 11 | |
| α-helix | 193-195 | 3 | |
| β-strand | 196-198 | 3 | 1 |
| α-helix | 207-221 | 15 | |
| α-helix | 222-224 | 3 | |
| β-strand | 230-238 | 9 | 2 |
| α-helix | 247-250 | 4 | |
| α-helix | 255 | 1 | |
| α-helix | 256-264 | 9 | |
| α-helix | 265-272 | 8 | |
| α-helix | 281-293 | 13 | |
| β-strand | 295 | 1 | 3 |
| α-helix | 296-299 | 4 | |
| α-helix | 300-302 | 3 | |
| β-strand | 303-309 | 7 | 2 |
| α-helix | 310 | 1 | |
| α-helix | 329 | 1 | |
| β-strand | 337-343 | 7 | 2 |
| β-strand | 344 | 1 | 3 |
| β-strand | 353-359 | 7 | 2 |
| β-strand | 366-373 | 8 | 2 |
| α-helix | 374-375 | 2 | |
| β-strand | 388-393 | 6 | 2 |
| β-strand | 401-404 | 4 | 2 |
| α-helix | 436-446 | 11 | |
| α-helix | 455-475 | 21 | |
| α-helix | 479 | 1 | |
| β-strand | 480-483 | 4 | 2 |
| α-helix | 490-498 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 32-37 | 6 | 4 |
| α-helix | 42 | 1 | |
| α-helix | 43-48 | 6 | |
| α-helix | 49-57 | 9 | |
| β-strand | 65-71 | 7 | 4 |
| α-helix | 77-82 | 6 | |
| α-helix | 86-88 | 3 | |
| α-helix | 95-102 | 8 | |
| β-strand | 105-109 | 5 | 4 |
| α-helix | 115-127 | 13 | |
| β-strand | 135-140 | 6 | 4 |
| α-helix | 147-153 | 7 | |
| α-helix | 154-158 | 5 | |
| β-strand | 165-169 | 5 | 4 |
| α-helix | 177-190 | 14 | |
| α-helix | 193-195 | 3 | |
| β-strand | 196-198 | 3 | 4 |
| α-helix | 207-221 | 15 | |
| α-helix | 222-224 | 3 | |
| β-strand | 230-238 | 9 | 5 |
| α-helix | 247-250 | 4 | |
| α-helix | 254-255 | 2 | |
| α-helix | 256-264 | 9 | |
| α-helix | 265-272 | 8 | |
| α-helix | 281-293 | 13 | |
| β-strand | 295 | 1 | 6 |
| α-helix | 300-302 | 3 | |
| β-strand | 303-309 | 7 | 5 |
| α-helix | 316-319 | 4 | |
| β-strand | 337-342 | 6 | 5 |
| β-strand | 344 | 1 | 6 |
| β-strand | 354-359 | 6 | 5 |
| β-strand | 366-373 | 8 | 5 |
| α-helix | 385-387 | 3 | |
| β-strand | 388-392 | 5 | 5 |
| β-strand | 401-404 | 4 | 5 |
| α-helix | 437-445 | 9 | |
| β-strand | 453 | 1 | 4 |
| α-helix | 455-474 | 20 | |
| α-helix | 477-479 | 3 | |
| β-strand | 480-483 | 4 | 5 |
| α-helix | 491-498 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glucose-6-phosphate 1-dehydrogenase | A, B | protein | 520 | Homo sapiens | P11413 (AlphaFold model) |
>7SEH_1 Glucose-6-phosphate 1-dehydrogenase (chains A, B) GSHMMAEQVALSRTQVCGILREELFQGDAFHQSDTHIFIIMGASGDLAKKKIYPTIWWLF RDGLLPENTFIVGYARSRLTVADIRKQSEPFFKATPEEKLKLEDFFARNSYVAGQYDDAA SYQRLNSHMNALHLGSQANRLFYLALPPTVYEAVTKNIHESCMSQIGWNRIIVEKPFGRD LQSSDRLSNHISSLFREDQIYRIDHYLGKEMVQNLMVLRFANRIFGPIWNRDNIACVILT FKEPFGTEGRGGYFDEFGIIRDVMQNHLLQMLCLVAMEKPCSTNSDDVRDEKVKVLKCIS EVQANNVVLGQYVGNPDGEGEATKGYLDDPTVPRGSTTATFAAVVLYVENERWDGVPFIL RCGKALNERKAEVRLQFHDVAGDIFHQQCKRNELVIRVQPNEAVYTQMMTKKPGMFFNPE ESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEK PKPIPYIYGSRGPTEADELMKRVGFQYEGTYKWVNPHKLC
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAP | NADP nicotinamide-adenine-dinucleotide phosphate | C21 H28 N7 O17 P3 | 2 |
Stabilization of glucose-6-phosphate dehydrogenase oligomers enhances catalytic activity and stability of clinical variants. Garcia, A.A., Mathews, I.I., Horikoshi, N. et al. J Biol Chem (2022) 298:101610-101610. DOI 10.1016/j.jbc.2022.101610 · PubMed
Other PDB entries of the same protein (UniProt P11413 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7SEH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.