The structure of crystalline profilin-beta-actin. Determined by X-ray diffraction at 2.55 Å resolution. Released 22 Jun 1994.
Explore 2BTF in 3D Show helices and sheets RCSB PDB PDBe
2BTF contains 29 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7 | 1 | |
| β-strand | 8-12 | 5 | 1 |
| β-strand | 16-21 | 6 | 1 |
| β-strand | 29-32 | 4 | 1 |
| β-strand | 35-37 | 3 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55-64 | 10 | |
| β-strand | 66-68 | 3 | 2 |
| β-strand | 71-72 | 2 | 3 |
| β-strand | 75-76 | 2 | 3 |
| α-helix | 79-88 | 10 | |
| α-helix | 89-94 | 6 | |
| α-helix | 98-100 | 3 | |
| β-strand | 103-107 | 5 | 1 |
| α-helix | 113-127 | 15 | |
| β-strand | 131-136 | 6 | 1 |
| α-helix | 137-145 | 9 | |
| β-strand | 150-155 | 6 | 4 |
| β-strand | 160-166 | 7 | 4 |
| β-strand | 169-170 | 2 | 4 |
| α-helix | 172-174 | 3 | |
| β-strand | 176-178 | 3 | 4 |
| α-helix | 182-195 | 14 | |
| α-helix | 203-206 | 4 | |
| α-helix | 208-216 | 9 | |
| α-helix | 223-231 | 9 | |
| β-strand | 238-241 | 4 | 5 |
| β-strand | 247-250 | 4 | 5 |
| α-helix | 253-256 | 4 | |
| α-helix | 258-260 | 3 | |
| α-helix | 271-273 | 3 | |
| α-helix | 274-282 | 9 | |
| α-helix | 290-295 | 6 | |
| β-strand | 297-300 | 4 | 4 |
| α-helix | 302-304 | 3 | |
| α-helix | 309-320 | 12 | |
| β-strand | 329-330 | 2 | 4 |
| α-helix | 338-346 | 9 | |
| α-helix | 350-353 | 4 | |
| β-strand | 357-358 | 2 | 1 |
| α-helix | 359-365 | 7 | |
| α-helix | 370-373 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-11 | 8 | |
| β-strand | 16-23 | 8 | 6 |
| β-strand | 29-33 | 5 | 6 |
| α-helix | 39-41 | 3 | |
| α-helix | 44-50 | 7 | |
| α-helix | 58-61 | 4 | |
| β-strand | 63-65 | 3 | 6 |
| β-strand | 68-75 | 8 | 6 |
| β-strand | 84-89 | 6 | 6 |
| β-strand | 99-104 | 6 | 6 |
| β-strand | 108-114 | 7 | 6 |
| α-helix | 115 | 1 | |
| α-helix | 120-135 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beta-actin | A | protein | 375 | Bos taurus | P60712 (AlphaFold model) |
| Profilin | P | protein | 140 | Bos taurus | P02584 (AlphaFold model) |
>2BTF_1 BETA-ACTIN (chains A) XDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF
>2BTF_2 PROFILIN (chains P) XAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY
The structure of crystalline profilin-beta-actin. Schutt, C.E., Myslik, J.C., Rozycki, M.D. et al. Nature (1993) 365:810-816. DOI 10.1038/365810a0 · PubMed
Other PDB entries of the same protein (UniProt P60712 (AlphaFold model), which also has an AlphaFold model), best resolution first:
2BTF is part of these collections:
MolViewer shows 2BTF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.