2CG7: Fibronectin

Second and third fibronectin type I module pair (crystal form II). Determined by X-ray diffraction at 1.2 Å resolution. Released 27 Feb 2007.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,034
Mol. weight: 10.12 kDa
Released: 27 Feb 2007

Explore 2CG7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CG7 contains 0 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	65-67	3	1
β-strand	74-76	3	1
β-strand	80-84	5	2
β-strand	89-96	8	2
β-strand	101-105	5	2
β-strand	109-112	4	3
β-strand	115-118	4	3
β-strand	122-126	5	4
β-strand	133-140	8	4
β-strand	145-150	6	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fibronectin	A	protein	90	HOMO SAPIENS	P02751 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CG7_1 FIBRONECTIN (chains A)
AEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGD
TWRRPHETGGYMLECVCLGNGKGEWTCKPI

Primary citation

The Solution and Crystal Structures of a Module Pair from the Staphylococcus Aureus-Binding Site of Human Fibronectin-A Tale with a Twist. Rudino-Pinera, E., Ravelli, R.B.G., Sheldrick, G.M. et al. J Mol Biol (2007) 368:833. DOI 10.1016/J.JMB.2007.02.061 · PubMed

Other PDB entries of the same protein (UniProt P02751 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LXO 1.42 Å, Crystal structure of 9,10Fn3-elegantin chimera
5DC4 1.48 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal a
2CG6 1.55 Å, Second and third fibronectin type I module pair (crystal form I).
5DC9 1.56 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal B
5N48 1.6 Å, Structure of Anticalin N9B in complex with extra-domain B of human oncofetal fibronectin
3CAL 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
3ZRZ 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
6MFA 1.75 Å, Fragment of human fibronectin containing the 4th-7th type III domains
1FNA 1.8 Å, Crystal structure of the tenth type III cell adhesion module of human fibronectin
2RKY 1.8 Å, Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a…
4PZ5 1.96 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
1FNF 2.0 Å, Fragment of human fibronectin encompassing type-III repeats 7 through 10

Browse structure collections

About this viewer

MolViewer shows 2CG7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.