6MFA: Fibronectin

Fragment of human fibronectin containing the 4th-7th type III domains. Determined by X-ray diffraction at 1.75 Å resolution. Released 18 Sept 2019.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,208
Mol. weight: 40.04 kDa
Released: 18 Sept 2019

Explore 6MFA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MFA contains 15 α-helices and 34 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 34 β-strands

Element	Residues	Length	Sheet
α-helix	907-910	4
β-strand	911-918	8	1
β-strand	923-928	6	1
α-helix	929-930	2
β-strand	936-943	8	2
β-strand	951	1	3
β-strand	952-957	6	2
β-strand	961-964	4	1
α-helix	967-968	2
β-strand	972-981	10	2
β-strand	984-985	2	2
α-helix	986-988	3
β-strand	989-994	6	2
α-helix	995-1000	6
β-strand	1001-1007	7	4
β-strand	1013-1018	6	4
β-strand	1026-1033	8	5
α-helix	1038-1039	2
β-strand	1040-1044	5	5
β-strand	1050-1053	4	4
α-helix	1056-1057	2
β-strand	1061-1070	10	5
β-strand	1073-1074	2	5
α-helix	1075-1077	3
β-strand	1078-1083	6	5
α-helix	1084-1086	3
β-strand	1094-1098	5	6
β-strand	1103-1107	5	6
β-strand	1113-1121	9	7
β-strand	1129-1133	5	7
β-strand	1137-1140	4	6
α-helix	1143-1144	2
β-strand	1148-1157	10	7
β-strand	1160	1	7
α-helix	1164-1165	2
β-strand	1166-1171	6	7
α-helix	1172-1177	6
β-strand	1178-1184	7	8
β-strand	1191-1196	6	8
α-helix	1197-1198	2
β-strand	1205-1212	8	9
β-strand	1221	1	3
β-strand	1222-1225	4	9
β-strand	1231-1234	4	8
β-strand	1243-1251	9	9
β-strand	1254-1255	2	9
α-helix	1256-1258	3
β-strand	1259-1263	5	9
α-helix	1265-1267	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fibronectin	A	protein	369	Homo sapiens	P02751 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6MFA_1 Fibronectin (chains A)
GSGRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRN
TFAEVTGLSPGVTYYFKVFAVSHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTP
PRAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPASEYTVSLVAIKGNQESPKAT
GVFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIV
VSGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERST
TPDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPI
SDTIIPAVP

Primary citation

Fragment of human fibronectin containing the 4th-7th type III domains, crystal form I. Mou, T.C., Loa, S., Sprang, S.R. et al. To be published.

Other PDB entries of the same protein (UniProt P02751 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2CG7 1.2 Å, Second and third fibronectin type I module pair (crystal form II).
4LXO 1.42 Å, Crystal structure of 9,10Fn3-elegantin chimera
5DC4 1.48 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal a
2CG6 1.55 Å, Second and third fibronectin type I module pair (crystal form I).
5DC9 1.56 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal B
5N48 1.6 Å, Structure of Anticalin N9B in complex with extra-domain B of human oncofetal fibronectin
3CAL 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
3ZRZ 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
1FNA 1.8 Å, Crystal structure of the tenth type III cell adhesion module of human fibronectin
2RKY 1.8 Å, Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a…
4PZ5 1.96 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
1FNF 2.0 Å, Fragment of human fibronectin encompassing type-III repeats 7 through 10

Browse structure collections

About this viewer

MolViewer shows 6MFA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.