Solution structures of the LIM domain of human NEDD9 interacting protein with calponin homology and LIM domains. Determined by solution NMR. Released 17 Nov 2005.
Explore 2CO8 in 3D Show helices and sheets RCSB PDB PDBe
2CO8 contains 0 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 1 |
| β-strand | 24 | 1 | 1 |
| β-strand | 30 | 1 | 2 |
| β-strand | 33 | 1 | 3 |
| β-strand | 36 | 1 | 3 |
| β-strand | 39 | 1 | 2 |
| β-strand | 44 | 1 | 4 |
| β-strand | 51 | 1 | 4 |
| β-strand | 57-58 | 2 | 5 |
| β-strand | 67-68 | 2 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| NEDD9 interacting protein with calponin homology and LIM domains | A | protein | 82 | Homo sapiens | Q8TDZ2 (AlphaFold model) |
>2CO8_1 NEDD9 interacting protein with calponin homology and LIM domains (chains A) GSSGSSGQHQEAGAGDLCALCGEHLYVLERLCVNGHFFHRSCFRCHTCEATLWPGGYEQH PGDGHFYCLQHLPQTDSGPSSG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Solution structures of the LIM domain of human NEDD9 interacting protein with calponin homology and LIM domains. Sato, M., Tomizawa, T., Saito, K. et al. To be published.
Other PDB entries of the same protein (UniProt Q8TDZ2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2CO8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.