2DK9: Calponin Homology domain of Human MICAL-1

Solution structure of Calponin Homology domain of Human MICAL-1. Determined by solution NMR. Released 19 Sept 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 885
Mol. weight: 12.58 kDa
Released: 19 Sept 2006

Explore 2DK9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DK9 contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	2-16	15
α-helix	30-32	3
α-helix	36-45	10
α-helix	47-49	3
α-helix	52-58	7
α-helix	60-74	15
α-helix	77-79	3
α-helix	83-88	6
α-helix	92-108	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
NEDD9-interacting protein with calponin homology and LIM domains	A	protein	118	Homo sapiens	Q8TDZ2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DK9_1 NEDD9-interacting protein with calponin homology and LIM domains (chains A)
MGHHHHHHMGSAGTQEELLRWCQEQTAGYPGVHVSDLSSSWADGLALCALVYRLQPGLLE
PSELQGLGALEATAWALKVAENELGITPVVSAQAVVAGSDPLGLIAYLSHFHSAFKSM

Primary citation

Solution structure of calponin homology domain of Human MICAL-1. Sun, H., Dai, H., Zhang, J. et al. J Biomol NMR (2006) 36:295-300. DOI 10.1007/s10858-006-9062-5 · PubMed

Other PDB entries of the same protein (UniProt Q8TDZ2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8HLO 1.17 Å, Crystal structure of ASAP1-SH3 and MICAL1-PRM complex
6KU0 1.6 Å, Crystal structure of MyoVa-GTD in complex with MICAL1-GTBM
9G0C 1.8 Å, Structure of human Mical1 bMERB_V978A_V985A domain:Rab10 complex.
9G0D 2.05 Å, Structure of human Mical1 bMERB_V978A domain:Rab10 complex.
5LPN 2.8 Å, Structure of human Rab10 in complex with the bMERB domain of Mical-1
9EWY 3.1 Å, CryoEM structure of human MICAL1
5LE0 3.3 Å, MICAL1 Cterminal domain
8Y6K 3.94 Å, Cryo-EM structure of full-length MICAL1 in the autoinhibited state
1WYL Solution structure of the CH domain of human NEDD9 interacting protein with calponin…
2CO8 Solution structures of the LIM domain of human NEDD9 interacting protein with calponin…

Browse structure collections

About this viewer

MolViewer shows 2DK9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.