2D3I: Aluminum-Bound Ovotransferrin

Crystal Structure of Aluminum-Bound Ovotransferrin at 2.15 Angstrom Resolution. Determined by X-ray diffraction at 2.15 Å resolution. Released 29 Nov 2005.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Gallus gallus
Chains: 1
Atoms: 5,469
Mol. weight: 76.13 kDa
Ligands: BCT, AL
Released: 29 Nov 2005

Explore 2D3I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2D3I contains 37 α-helices and 30 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 37 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	6-11	6	1
α-helix	14-26	13
β-strand	33-38	6	1
α-helix	42-50	9
β-strand	56	1	1
β-strand	57-59	3	2
α-helix	61-68	8
β-strand	75-81	7	2
β-strand	82	1	3
β-strand	89	1	3
β-strand	91-99	9	4
α-helix	106-108	3
β-strand	113-116	4	4
α-helix	122-126	5
α-helix	127-134	8
α-helix	143-145	3
α-helix	148-155	8
β-strand	158-160	3	4
α-helix	168-170	3
α-helix	190-199	10
β-strand	205-209	5	4
α-helix	212-216	5
α-helix	218-223	6
β-strand	224-227	4	4
β-strand	233-234	2	4
α-helix	236-241	6
β-strand	245-248	4	4
α-helix	249-250	2
β-strand	251-254	4	2
α-helix	260-274	15
α-helix	293-295	3
β-strand	306-309	4	2
α-helix	316-320	5
α-helix	322-330	9
β-strand	345-350	6	5
α-helix	351-364	14
β-strand	369-374	6	5
α-helix	377-386	10
β-strand	391	1	5
β-strand	392-394	3	6
α-helix	396-404	9
β-strand	408-414	7	6
α-helix	418-420	3
β-strand	431-438	8	7
β-strand	452-455	4	7
α-helix	461-465	5
α-helix	466-475	10
α-helix	480-482	3
β-strand	486-488	3	7
α-helix	497-499	3
α-helix	523-533	11
β-strand	537-541	5	7
α-helix	544-547	4
α-helix	563-565	3
β-strand	566-569	4	7
α-helix	570	1
β-strand	575-577	3	7
α-helix	578-583	6
β-strand	587-589	3	7
α-helix	590-592	3
β-strand	593-596	4	6
α-helix	598-600	3
α-helix	601-615	15
β-strand	643-646	4	6
α-helix	653-657	5
α-helix	659-668	10
α-helix	675-684	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ovotransferrin	A	protein	686	Gallus gallus	P02789 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2D3I_1 Ovotransferrin (chains A)
APPKSVIRWCTISSPEEKKCNNLRDLTQQERISLTCVQKATYLDCIKAIANNEADAISLD
GGQVFEAGLAPYKLKPIAAEVYEHTEGSTTSYYAVAVVKKGTEFTVNDLQGKTSCHTGLG
RSAGWNIPIGTLIHRGAIEWEGIESGSVEQAVAKFFSASCVPGATIEQKLCRQCKGDPKT
KCARNAPYSGYSGAFHCLKDGKGDVAFVKHTTVNENAPDQKDEYELLCLDGSRQPVDNYK
TCNWARVAAHAVVARDDNKVEDIWSFLSKAQSDFGVDTKSDFHLFGPPGKKDPVLKDLLF
KDSAIMLKRVPSLMDSQLYLGFEYYSAIQSMRKDQLTPSPRENRIQWCAVGKDEKSKCDR
WSVVSNGDVECTVVDETKDCIIKIMKGEADAVALDGGLVYTAGVCGLVPVMAERYDDESQ
CSKTDERPASYFAVAVARKDSNVNWNNLKGKKSCHTAVGRTAGWVIPMGLIHNRTGTCNF
DEYFSEGCAPGSPPNSRLCQLCQGSGGIPPEKCVASSHEKYFGYTGALRCLVEKGDVAFI
QHSTVEENTGGKNKADWAKNLQMDDFELLCTDGRRANVMDYRECNLAEVPTHAVVVRPEK
ANKIRDLLERQEKRFGVNGSEKSKFMMFESQNKDLLFKDLTKCLFKVREGTTYKEFLGDK
FYTVISSLKTCNPSDILQMCSFLEGK

Ligands and cofactors

ID	Name	Formula	Copies
BCT	Bicarbonate ion	C H O3	2
AL	Aluminum ion	Al	2

Primary citation

Structure of aluminium-bound ovotransferrin at 2.15 Angstroms resolution. Mizutani, K., Mikami, B., Aibara, S. et al. Acta Crystallogr D Biol Crystallogr (2005) 61:1636-1642. DOI 10.1107/S090744490503266X · PubMed

Other PDB entries of the same protein (UniProt P02789 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8X3H 0.93 Å, Crystal structure of iron-bound recombinant ovotransferrin N-lobe at 0.93 angstrom…
1IEJ 1.65 Å, Ovotransferrin, N-terminal lobe, holo form, at 1.65 a resolution
1TFA 1.9 Å, Ovotransferrin, N-terminal lobe, apo form
1NFT 2.1 Å, Ovotransferrin, N-terminal lobe, iron loaded open form
1IQ7 2.3 Å, Ovotransferrin, C-Terminal Lobe, Apo Form
1NNT 2.3 Å, Structural evidence for a PH-sensitive di-lysine trigger in the hen ovotransferrin…
1OVT 2.4 Å, Refined crystallographic structure of hen ovotransferrin at 2.4 Å resolution
1N04 2.8 Å, Diferric chicken serum transferrin at 2.8 A resolution.
1AIV 3.0 Å, Apo ovotransferrin
8FEI 3.0 Å, CryoEM structure of Conalbumin from chicken egg white (sigma-Cas 1391-06-6)
1D9K 3.2 Å, Crystal structure of complex between D10 TCR and pmhc I-ak/ca
1RYX 3.5 Å, Crystal structure of hen serum transferrin in apo- form

Browse structure collections

About this viewer

MolViewer shows 2D3I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.