2D96: Death domain of Nuclear factor NF-kappa-B p100

Solution structure of the Death domain of Nuclear factor NF-kappa-B p100. Determined by solution NMR. Released 8 Dec 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 786
Mol. weight: 11.22 kDa
Released: 8 Dec 2006

Explore 2D96 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2D96 contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	14-24	11
α-helix	33-40	8
α-helix	43-50	8
α-helix	55-65	11
α-helix	70-80	11
α-helix	83-90	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear factor NF-kappa-B p100 subunit	A	protein	109	Homo sapiens	Q00653 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2D96_1 Nuclear factor NF-kappa-B p100 subunit (chains A)
GSSGSSGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLL
RSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVSGPSSG

Primary citation

Solution structure of the Death domain of Nuclear factor NF-kappa-B p100. Nagashima, T., Hayashi, F., Yokoyama, S. To be published.

Other PDB entries of the same protein (UniProt Q00653 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1A3Q 2.1 Å, Human nf-kappa-B P52 bound to DNA
8G8S 2.1 Å, bipartite p52 NLS in complex with Importin alpha 2
8G8Q 2.6 Å, Monopartite p52 NLS in complex with Importin alpha 2
5ZMC 2.99 Å, Structural Basis for Reactivation of -146C>T Mutant TERT Promoter by cooperative binding…
7CLI 3.0 Å, Structure of NF-kB p52 homodimer bound to P-Selectin kB DNA fragment
7W7L 3.0 Å, Structure of NF-kB p52 homodimer bound to 13-mer A/T-centric P-Selectin kB DNA fragment
3DO7 3.05 Å, X-ray structure of a NF-kB p52/RelB/DNA complex
7VUQ 3.1 Å, Structure of NF-kB p52 homodimer bound to A/T-centric P-Selectin kB DNA fragment
4OT9 3.35 Å, crystal structure of the C-terminal domain of p100/NF-kB2
7VUP 3.4 Å, Structure of NF-kB p52 homodimer bound to +1/-1 swap P-Selectin kB DNA fragment

Browse structure collections

About this viewer

MolViewer shows 2D96 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.