2DA0: PDB entry 2DA0

Solution structure of the PH domain of PIP2-dependent ARF1 GTPase-activating protein from human. Determined by solution NMR. Released 13 Jun 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 886
Mol. weight: 12.63 kDa
Released: 13 Jun 2006

Explore 2DA0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DA0 contains 1 α-helix and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	12-19	8	1
β-strand	27-35	9	1
β-strand	38-41	4	1
β-strand	51-54	4	1
β-strand	59-62	4	1
β-strand	70-74	5	1
β-strand	77-82	6	1
α-helix	86-104	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
130-kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein	A	protein	114	Homo sapiens	Q9ULH1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DA0_1 130-kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein (chains A)
GSSGSSGYGSEKKGYLLKKSDGIRKVWQRRKCSVKNGILTISHATSNRQPAKLNLLTCQV
KPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALTMAFSGPSSG

Primary citation

Solution structure of the PH domain of PIP2-dependent ARF1 GTPase-activating protein from human. Li, H., Tomizawa, T., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q9ULH1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2D1X 1.9 Å, The crystal structure of the cortactin-SH3 domain and AMAP1-peptide complex
2ED1 Solution structure of the SH3 domain of 130 kDa phosphatidylinositol…
2RQT Solution structure of the human DDEF1 SH3 domain
2RQU Solution structure of the complex between the DDEF1 SH3 domain and the APC SAMP1 motif

Browse structure collections

About this viewer

MolViewer shows 2DA0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.