Solution structure of the SH3 domain of 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein. Determined by solution NMR. Released 26 Feb 2008.
Explore 2ED1 in 3D Show helices and sheets RCSB PDB PDBe
2ED1 contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11-15 | 5 | 1 |
| β-strand | 26 | 1 | 1 |
| α-helix | 27-28 | 2 | |
| β-strand | 34-37 | 4 | 1 |
| β-strand | 45-50 | 6 | 1 |
| β-strand | 57-61 | 5 | 1 |
| α-helix | 62-64 | 3 | |
| β-strand | 65-67 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein | A | protein | 76 | Homo sapiens | Q9ULH1 (AlphaFold model) |
>2ED1_1 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein (chains A) GSSGSSGNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVF PVSFVHILSDSGPSSG
Solution structure of the SH3 domain of 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein. Abe, H., Tochio, N., Miyamoto, K. et al. To be published.
Other PDB entries of the same protein (UniProt Q9ULH1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2ED1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.