2DJ8: Zf-MYND Domain of Protein CBFA2TI

Solution Structure of zf-MYND Domain of Protein CBFA2TI (Protein MTG8). Determined by solution NMR. Released 1 Oct 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 444
Mol. weight: 6.54 kDa
Ligands: ZN
Released: 1 Oct 2006

Explore 2DJ8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DJ8 contains 3 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	27-28	2	1
β-strand	36-37	2	1
α-helix	40-45	6
α-helix	47-50	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein CBFA2T1	A	protein	60	Homo sapiens	Q06455 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DJ8_1 Protein CBFA2T1 (chains A)
GSSGSSGINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICSGPSSG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Solution Structure of zf-MYND Domain of Protein CBFA2TI (Protein MTG8). Niraula, T.N., Sasagawa, A., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q06455 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WQ6 2.0 Å, The tetramer structure of the nervy homolgy two (NHR2) domain of AML1-ETO is critical…
4JOL 2.91 Å, Complex structure of AML1-ETO NHR2 domain with HEB fragment
2H7B Solution structure of the eTAFH domain from the human leukemia-associated fusion protein…
2KNH The Solution structure of the eTAFH domain of AML1-ETO complexed with HEB peptide
2KYG Structure of the AML1-ETO Nervy Domain - PKA(RIIa) complex and its contribution to…
2OD1 Solution structure of the MYND domain from human AML1-ETO
2ODD Solution structure of the MYND domain from AML1-ETO complexed with SMRT, a corepressor
2PP4 Solution Structure of ETO-TAFH refined in explicit solvent

Browse structure collections

About this viewer

MolViewer shows 2DJ8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.