2DJV: Methionyl-tRNA synthetase

Solution structures of the WHEP-TRS domain of human methionyl-tRNA synthetase. Determined by solution NMR. Released 5 Oct 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 572
Mol. weight: 8.2 kDa
Released: 5 Oct 2006

Explore 2DJV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DJV contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	11-34	24
α-helix	39-60	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Methionyl-tRNA synthetase	A	protein	79	Homo sapiens	P56192 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DJV_1 Methionyl-tRNA synthetase (chains A)
GSSGSSGTTAKPQQIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAKLLDLKKQLAVAE
GKPPEAPKGKKKKSGPSSG

Primary citation

Solution structures of the WHEP-TRS domain of human methionyl-tRNA synthetase. Sato, M., Sasagawa, A., Tochio, N. et al. To be published.

Other PDB entries of the same protein (UniProt P56192 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4BVX 1.6 Å, Crystal structure of the AIMP3-MRS N-terminal domain complex with I3C
4BL7 1.89 Å, Crystal structure of the AIMP3-MRS N-terminal domain complex in different space group
4BVY 1.99 Å, Crystal structure of the AIMP3-MRS N-terminal domain complex
5GL7 2.01 Å, Crystal structure of a truncated human cytosolic methionyl-tRNA synthetase
5GOY 2.28 Å, The crystal structure of human cytosolic methionyl-tRNA synthetase in complex with…
5Y6L 2.9 Å, A subcomplex crystal structure of human cytosolic aspartyl-tRNA synthetase and…

Browse structure collections

About this viewer

MolViewer shows 2DJV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.