The crystal structure of human cytosolic methionyl-tRNA synthetase in complex with methionine. Determined by X-ray diffraction at 2.28 Å resolution. Released 2 Aug 2017.
Explore 5GOY in 3D Show helices and sheets RCSB PDB PDBe
5GOY contains 37 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 230-242 | 13 | |
| α-helix | 243-246 | 4 | |
| α-helix | 248-250 | 3 | |
| β-strand | 265-270 | 6 | 1 |
| β-strand | 274 | 1 | 2 |
| β-strand | 280 | 1 | 3 |
| α-helix | 281-286 | 6 | |
| α-helix | 288-300 | 13 | |
| β-strand | 304-311 | 8 | 1 |
| β-strand | 312 | 1 | 2 |
| α-helix | 316-324 | 9 | |
| α-helix | 329-346 | 18 | |
| β-strand | 353-356 | 4 | 1 |
| α-helix | 360-374 | 15 | |
| β-strand | 379-389 | 11 | 4 |
| β-strand | 394-395 | 2 | 4 |
| α-helix | 396-397 | 2 | |
| β-strand | 401-404 | 4 | 5 |
| β-strand | 413-414 | 2 | 5 |
| β-strand | 417 | 1 | 6 |
| β-strand | 424 | 1 | 6 |
| α-helix | 427-429 | 3 | |
| β-strand | 431-435 | 5 | 5 |
| β-strand | 443-452 | 10 | 4 |
| α-helix | 454-468 | 15 | |
| α-helix | 476-488 | 13 | |
| β-strand | 493-494 | 2 | 4 |
| β-strand | 496-497 | 2 | 7 |
| α-helix | 503 | 1 | |
| β-strand | 504 | 1 | 7 |
| α-helix | 505 | 1 | |
| β-strand | 514-515 | 2 | 7 |
| α-helix | 517-520 | 4 | |
| α-helix | 524-532 | 9 | |
| α-helix | 537-540 | 4 | |
| β-strand | 546-553 | 8 | 1 |
| α-helix | 554-556 | 3 | |
| α-helix | 557-558 | 2 | |
| α-helix | 559-563 | 5 | |
| α-helix | 564-571 | 8 | |
| β-strand | 578-584 | 7 | 1 |
| β-strand | 587-589 | 3 | 8 |
| β-strand | 592 | 1 | 8 |
| β-strand | 595 | 1 | 9 |
| β-strand | 600 | 1 | 9 |
| β-strand | 603 | 1 | 3 |
| α-helix | 607-609 | 3 | |
| α-helix | 614-623 | 10 | |
| β-strand | 631-633 | 3 | 8 |
| α-helix | 635-641 | 7 | |
| α-helix | 642-651 | 10 | |
| α-helix | 652-664 | 13 | |
| β-strand | 668 | 1 | 10 |
| α-helix | 669-671 | 3 | |
| α-helix | 676-696 | 21 | |
| α-helix | 701-722 | 22 | |
| α-helix | 724-727 | 4 | |
| α-helix | 732-756 | 25 | |
| α-helix | 761-771 | 11 | |
| α-helix | 775-778 | 4 | |
| α-helix | 793 | 1 | |
| β-strand | 794 | 1 | 10 |
| α-helix | 795 | 1 | |
| α-helix | 804-806 | 3 | |
| α-helix | 807-816 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Methionine--tRNA ligase, cytoplasmic | A | protein | 624 | Homo sapiens | P56192 (AlphaFold model) |
>5GOY_1 Methionine--tRNA ligase, cytoplasmic (chains A) MSEEEELATLSEEEIAMAVTAWEKGLESLPPLRPQQNPVLPVAGERNVLITSALPYVNNV PHLGNIIGCVLSADVFARYSRLRQWNTLYLCGTDEYGTATETKALEEGLTPQEICDKYHI IHADIYRWFNISFDIFGRTTTPQQTKITQDIFQQLLKRGFVLQDTVEQLRCEHCARFLAD RFVEGVCPFCGYEEARGDQCDKCGKLINAVELKKPQCKVCRSCPVVQSSQHLFLDLPKLE KRLEEWLGRTLPGSDWTPNAQFITRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVW FDATIGYLSITANYTDQWERWWKNPEQVDLYQFMAKDNVPFHSLVFPCSALGAEDNYTLV SHLIATEYLNYEDGKFSKSRGVGVFGDMAQDTGIPADIWRFYLLYIRPEGQDSAFSWTDL LLKNNSELLNNLGNFINRAGMFVSKFFGGYVPEMVLTPDDQRLLAHVTLELQHYHQLLEK VRIRDALRSILTISRHGNQYIQVNEPWKRIKGSEADRQRAGTVTGLAVNIAALLSVMLQP YMPTVSATIQAQLQLPPPACSILLTNFLCTLPAGHQIGTVSPLFQKLENDQIESLRQRFG GGQAKTSPKPAVVETVLEHHHHHH
The crystal structure of human cytosolic methionyl-tRNA synthetase in complex with methionine. Lee, H.J., Cho, H.Y., Kang, B.S. To be published.
Other PDB entries of the same protein (UniProt P56192 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5GOY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.