2DJY: Smurf2 WW3 domain-Smad7 PY peptide complex

Solution structure of Smurf2 WW3 domain-Smad7 PY peptide complex. Determined by solution NMR. Released 2 May 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 481
Mol. weight: 6.81 kDa
Released: 2 May 2006

Explore 2DJY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DJY contains 0 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	303-307	5	1
β-strand	313-317	5	1
β-strand	322-324	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Smad ubiquitination regulatory factor 2	A	protein	42	Homo sapiens	Q9HAU4 (AlphaFold model)
Mothers against decapentaplegic homolog 7	B	protein	20	Homo sapiens	O15105 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DJY_1 Smad ubiquitination regulatory factor 2 (chains A)
GPLGSGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSAN

Sequence of entity 2 (B), FASTA

>2DJY_2 Mothers against decapentaplegic homolog 7 (chains B)
GPLGSELESPPPPYSRYPMD

Primary citation

An Expanded WW Domain Recognition Motif Revealed by the Interaction between Smad7 and the E3 Ubiquitin Ligase Smurf2. Chong, P.A., Lin, H., Wrana, J.L. et al. J Biol Chem (2006) 281:17069-17075. DOI 10.1074/jbc.M601493200 · PubMed

Other PDB entries of the same protein (UniProt Q9HAU4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9FSH 2.08 Å, Crystal structure of the HECT domain of Smurf 2 in complex with inhibitor 8
1ZVD 2.1 Å, Regulation of Smurf2 Ubiquitin Ligase Activity by Anchoring the E2 to the HECT domain
6FX4 2.5 Å, Disulfide between E3 HECT ligase Smurf2 and Ubiquitin G76C
7M3Q 2.5 Å, Structure of the Smurf2 HECT Domain with a High Affinity Ubiquitin Variant (UbV)
2JQZ Solution Structure of the C2 domain of human Smurf2
2KXQ Solution Structure of Smurf2 WW2 and WW3 bound to Smad7 PY motif containing peptide
2LTZ Smurf2 WW3 domain in complex with a Smad7 derived peptide

Browse structure collections

About this viewer

MolViewer shows 2DJY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.