2DKQ: PTB domain of KIAA1075 protein from human

Solution structure of the PTB domain of KIAA1075 protein from human. Determined by solution NMR. Released 13 Oct 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,193
Mol. weight: 16.98 kDa
Released: 13 Oct 2006

Explore 2DKQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DKQ contains 4 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	12-16	5
β-strand	20-30	11	1
α-helix	36-49	14
β-strand	57-64	8	1
β-strand	67-72	6	1
β-strand	80-84	5	1
β-strand	90-93	4	1
β-strand	99	1	2
β-strand	102	1	3
β-strand	106	1	3
β-strand	109	1	2
β-strand	110-116	7	1
β-strand	124-130	7	1
α-helix	138-145	8
α-helix	146-151	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
KIAA1075 protein	A	protein	160	Homo sapiens	Q63HR2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DKQ_1 KIAA1075 protein (chains A)
GSSGSSGMSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVH
FKVSAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGS
PWENVCHLFAELDPDQPAGAIVTFITKVLLGQRKSGPSSG

Primary citation

Solution structure of the PTB domain of KIAA1075 protein from human. Li, H., Tochio, N., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q63HR2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HQC 1.8 Å, Crystal structure of Phosphotyrosine-binding domain from the Human Tensin-like C1…
2KNO NMR Solution Structure of SH2 Domain of the Human Tensin Like C1 Domain Containing…
2L6K Solution Structure of a Nonphosphorylated Peptide Recognizing Domain
2LOZ The novel binding mode of DLC1 and Tensin2 PTB domain

Browse structure collections

About this viewer

MolViewer shows 2DKQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.