3HQC: Tensin-like C1 domain-containing phosphatase

Crystal structure of Phosphotyrosine-binding domain from the Human Tensin-like C1 domain-containing phosphatase (TENC1). Determined by X-ray diffraction at 1.8 Å resolution. Released 21 Jul 2009.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,229
Mol. weight: 17.81 kDa
Released: 21 Jul 2009

Explore 3HQC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3HQC contains 5 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	1266-1272	7
β-strand	1274-1285	12	1
α-helix	1291-1304	14
α-helix	1311	1
β-strand	1312-1319	8	1
β-strand	1322-1329	8	1
β-strand	1332-1339	8	1
α-helix	1340-1342	3
β-strand	1343-1348	6	1
β-strand	1354-1356	3	2
β-strand	1362-1364	3	2
β-strand	1365-1372	8	1
β-strand	1375-1385	11	1
β-strand	1388	1	3
β-strand	1391	1	3
α-helix	1393-1405	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tensin-like C1 domain-containing phosphatase	A	protein	157	Homo sapiens	Q63HR2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3HQC_1 Tensin-like C1 domain-containing phosphatase (chains A)
MSLSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSA
QGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENV
CHLFAELDPDQPAGAIVTFITKVMLGQRKEGHHHHHH

Primary citation

Crystal structure of Phosphotyrosine-binding domain from the Human Tensin-like C1 domain-containing phosphatase (TENC1). Sampathkumar, P., Romero, R., Wasserman, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q63HR2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2DKQ Solution structure of the PTB domain of KIAA1075 protein from human
2KNO NMR Solution Structure of SH2 Domain of the Human Tensin Like C1 Domain Containing…
2L6K Solution Structure of a Nonphosphorylated Peptide Recognizing Domain
2LOZ The novel binding mode of DLC1 and Tensin2 PTB domain

Browse structure collections

About this viewer

MolViewer shows 3HQC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.