2KNO: Tensin-like C1 domain-containing phosphatase

NMR Solution Structure of SH2 Domain of the Human Tensin Like C1 Domain Containing Phosphatase (TENC1). Determined by solution NMR. Released 1 Sept 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,016
Mol. weight: 14.4 kDa
Released: 1 Sept 2010

Explore 2KNO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KNO contains 4 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	19-22	4
β-strand	23	1	1
α-helix	29-36	8
β-strand	41	1	2
β-strand	43	1	2
β-strand	44-48	5	1
β-strand	55-61	7	1
α-helix	76-80	5
β-strand	81-87	7	1
β-strand	95-96	2	1
α-helix	107-112	6
β-strand	126	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tensin-like C1 domain-containing phosphatase	A	protein	131	Homo sapiens	Q63HR2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KNO_1 Tensin-like C1 domain-containing phosphatase (chains A)
MHHHHHHSSGLVPRGSDTSKFWYKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLAL
KVATPPPSAQPWKGDPVEQLVRHFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPIS
LPCCLRIPSKD

Primary citation

NMR Solution Structure of SH2 Domain of the Human Tensin Like C1 Domain Containing Phosphatase (TENC1). Chen, L., Liu, C., Feng, R. et al. To be published.

Other PDB entries of the same protein (UniProt Q63HR2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HQC 1.8 Å, Crystal structure of Phosphotyrosine-binding domain from the Human Tensin-like C1…
2DKQ Solution structure of the PTB domain of KIAA1075 protein from human
2L6K Solution Structure of a Nonphosphorylated Peptide Recognizing Domain
2LOZ The novel binding mode of DLC1 and Tensin2 PTB domain

Browse structure collections

About this viewer

MolViewer shows 2KNO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.