2L6K: Nonphosphorylated Peptide Recognizing Domain

Solution Structure of a Nonphosphorylated Peptide Recognizing Domain. Determined by solution NMR. Released 12 Oct 2011.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 888
Mol. weight: 13.69 kDa
Released: 12 Oct 2011

Explore 2L6K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L6K contains 5 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-7	4
β-strand	8-9	2	1
α-helix	14-21	8
β-strand	29-33	5	1
β-strand	40-46	7	1
α-helix	63-65	3
β-strand	66-74	9	1
β-strand	77-80	4	1
β-strand	81	1	2
β-strand	83	1	2
β-strand	89	1	1
α-helix	92-98	7
α-helix	109-111	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tensin-like C1 domain-containing phosphatase	A	protein	123	Homo sapiens	Q63HR2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L6K_1 Tensin-like C1 domain-containing phosphatase (chains A)
MDTSKFWYKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGD
PVEQLVRHFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPISLPCCLRIPSKLEHHH
HHH

Primary citation

Solution structure of Tensin2 SH2 domain and its phosphotyrosine-independent interaction with DLC-1. Dai, K., Liao, S., Zhang, J. et al. PLoS One (2011) 6:e21965-e21965. DOI 10.1371/journal.pone.0021965 · PubMed

Other PDB entries of the same protein (UniProt Q63HR2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HQC 1.8 Å, Crystal structure of Phosphotyrosine-binding domain from the Human Tensin-like C1…
2DKQ Solution structure of the PTB domain of KIAA1075 protein from human
2KNO NMR Solution Structure of SH2 Domain of the Human Tensin Like C1 Domain Containing…
2LOZ The novel binding mode of DLC1 and Tensin2 PTB domain

Browse structure collections

About this viewer

MolViewer shows 2L6K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.