2DL3: Sorbin and SH3 domain-containing protein 1

Solution structure of the first SH3 domain of human sorbin and Sh3 domain-containing protein 1. Determined by solution NMR. Released 17 Oct 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 537
Mol. weight: 7.59 kDa
Released: 17 Oct 2006

Explore 2DL3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DL3 contains 0 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
β-strand	16	1	2
β-strand	23	1	1
β-strand	26	1	2
β-strand	31-36	6	1
β-strand	42-46	5	1
β-strand	51-55	5	1
β-strand	59-61	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorbin and SH3 domain-containing protein 1	A	protein	68	Homo sapiens	Q9BX66 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DL3_1 Sorbin and SH3 domain-containing protein 1 (chains A)
GSSGSSGRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIE
LLSGPSSG

Primary citation

Solution structure of the first SH3 domain of human sorbin and Sh3 domain-containing protein 1. Qin, X.R., Nagashima, T., Hayashi, F. et al. To be published.

Other PDB entries of the same protein (UniProt Q9BX66 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2O9S 0.83 Å, The second SH3 domain from ponsin
4LN2 1.0 Å, The second SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
4LNP 1.41 Å, The first SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
2O31 1.5 Å, Crystal structure of the second SH3 domain from ponsin
2O9V 1.63 Å, The second SH3 domain from Ponsin in complex with the paxillin proline rich region
2ECZ Solution structure of the SH3 domain of Sorbin and SH3 domain-containing protein 1
2LJ0 The third SH3 domain of R85FL
2LJ1 The third SH3 domain of R85FL with ataxin-7 PRR
2MOX solution structure of tandem SH3 domain of Sorbin and SH3 domain-containing protein 1
2O2W Extending powder diffraction to proteins: structure solution of the second SH3 domain…

Browse structure collections

About this viewer

MolViewer shows 2DL3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.