The second SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin. Determined by X-ray diffraction at 1.0 Å resolution. Released 28 May 2014.
Explore 4LN2 in 3D Show helices and sheets RCSB PDB PDBe
4LN2 contains 2 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 870-874 | 5 | 1 |
| β-strand | 878 | 1 | 2 |
| β-strand | 885 | 1 | 1 |
| β-strand | 888 | 1 | 2 |
| β-strand | 893-899 | 7 | 1 |
| β-strand | 904-908 | 5 | 1 |
| β-strand | 915-919 | 5 | 1 |
| α-helix | 920-922 | 3 | |
| β-strand | 923-927 | 5 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 860-866 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sorbin and SH3 domain-containing protein 1 | A | protein | 68 | Homo sapiens | Q9BX66 (AlphaFold model) |
| proline rich peptide | B | protein | 11 | Homo sapiens | P18206 (AlphaFold model) |
>4LN2_1 Sorbin and SH3 domain-containing protein 1 (chains A) QHMVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITY VDVIKRPL
>4LN2_2 proline rich peptide (chains B) ELAPPKPPLPE
Structural investigation of the interaction between the tandem SH3 domains of c-Cbl-associated protein and vinculin. Zhao, D., Wang, X., Peng, J. et al. J Struct Biol (2014) 187:194-205. DOI 10.1016/j.jsb.2014.05.009 · PubMed
Other PDB entries of the same protein (UniProt Q9BX66 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4LN2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.