The third SH3 domain of R85FL. Determined by solution NMR. Released 5 Sept 2012.
Explore 2LJ0 in 3D Show helices and sheets RCSB PDB PDBe
2LJ0 contains 0 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-11 | 4 | 1 |
| β-strand | 15 | 1 | 2 |
| β-strand | 22 | 1 | 1 |
| β-strand | 25 | 1 | 2 |
| β-strand | 30-36 | 7 | 1 |
| β-strand | 41-46 | 6 | 1 |
| β-strand | 52-56 | 5 | 1 |
| β-strand | 60-62 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sorbin and SH3 domain-containing protein 1 | A | protein | 65 | Homo sapiens | Q9BX66 (AlphaFold model) |
>2LJ0_1 Sorbin and SH3 domain-containing protein 1 (chains A) QTSQDLFSYQALYSYIPQNDDELELRDGDIVDVMEKCDDGWFVGTSRRTKQFGTFPGNYV KPLYL
Structure Basis for the Recognition of Ataxin-7 PRR with R85FL SH3 Domain. Jiang, Y., Zhou, C., Zhou, Z. et al. To be published.
Other PDB entries of the same protein (UniProt Q9BX66 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2LJ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.