Killer immunoglobulin receptor 2DL2,TRIGONAL form. Determined by X-ray diffraction at 2.9 Å resolution. Released 13 Jan 2000.
Explore 2DLI in 3D Show helices and sheets RCSB PDB PDBe
2DLI contains 3 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-11 | 3 | 1 |
| β-strand | 17-19 | 3 | 2 |
| β-strand | 24-30 | 7 | 1 |
| β-strand | 36-40 | 5 | 3 |
| β-strand | 48-51 | 4 | 3 |
| β-strand | 54 | 1 | 1 |
| β-strand | 60-66 | 7 | 1 |
| β-strand | 75-77 | 3 | 4 |
| β-strand | 78-82 | 5 | 3 |
| α-helix | 91-96 | 6 | |
| β-strand | 97-99 | 3 | 4 |
| β-strand | 100-102 | 3 | 2 |
| β-strand | 109-112 | 4 | 5 |
| β-strand | 117 | 1 | 6 |
| β-strand | 123-129 | 7 | 5 |
| β-strand | 136-140 | 5 | 7 |
| β-strand | 148-151 | 4 | 7 |
| β-strand | 153 | 1 | 8 |
| α-helix | 154-155 | 2 | |
| β-strand | 161 | 1 | 8 |
| β-strand | 163-168 | 6 | 5 |
| β-strand | 173-175 | 3 | 9 |
| β-strand | 176-180 | 5 | 7 |
| β-strand | 187 | 1 | 2 |
| α-helix | 190-194 | 5 | |
| β-strand | 195-197 | 3 | 9 |
| β-strand | 198 | 1 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (MHC class I nk cell receptor precursor) | A | protein | 197 | Homo sapiens | P43627 (AlphaFold model) |
>2DLI_1 PROTEIN (MHC CLASS I NK CELL RECEPTOR PRECURSOR) (chains A) VHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKAN FSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGES VTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRD SPYEWSNSSDPLLVSVI
Crystal structure of the HLA-Cw3 allotype-specific killer cell inhibitory receptor KIR2DL2. Snyder, G.A., Brooks, A.G., Sun, P.D. Proc Natl Acad Sci U S A (1999) 96:3864-3869. DOI 10.1073/pnas.96.7.3864 · PubMed
Other PDB entries of the same protein (UniProt P43627 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2DLI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.