2DLL: Interferon regulatory factor 4

Solution structure of the IRF domain of human interferon regulator factors 4. Determined by solution NMR. Released 20 Oct 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 983
Mol. weight: 13.91 kDa
Released: 20 Oct 2006

Explore 2DLL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DLL contains 5 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	9-19	11
β-strand	26-27	2	1
β-strand	34-38	5	1
α-helix	49-52	4
α-helix	54-63	10
β-strand	68	1	2
β-strand	71	1	2
α-helix	72-73	2
α-helix	75-88	14
β-strand	92-94	3	1
β-strand	100	1	1
β-strand	107-112	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon regulatory factor 4	A	protein	121	Homo sapiens	Q15306 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DLL_1 Interferon regulatory factor 4 (chains A)
GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWA
LFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSS
G

Primary citation

Solution structure of the IRF domain of human interferon regulator factors 4. Zhang, H.P., Kurosaki, C., Yoshida, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q15306 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TD4 1.71 Å, IRF4 DNA-binding domain surface entropy mutant apo structure
9VEH 2.0 Å, The MIDN Catch-IRF4 (A8M) fusion protein
9TOY 2.1 Å, Investigating the binding mechanism of Interferon Regulatory Factor 4 to DNA in the…
9VE3 2.1 Å, The MIDN Catch-IRF4 (V2L) fusion protein
9VE7 2.15 Å, The MIDN Catch-IRF4 (A8V) fusion protein
7OOT 2.25 Å, X-ray Structure of Interferon Regulatory Factor 4 DNA binding domain bound to an…
7OGS 2.37 Å, X-ray Structure of Interferon Regulatory Factor 4 DNA binding domain bound to an…
7RH2 2.47 Å, IRF4 Transcription factor mutant -K59R
9CUG 2.49 Å, X-ray Structure of human Interferon Regulatory Factor 4 (IRF4) IAD Domain
9VE4 2.55 Å, The MIDN Catch-IRF4 fusion protein
7O56 2.6 Å, X-ray Structure of Interferon Regulatory Factor 4 DNA binding domain bound to an…
9VE6 2.8 Å, The MIDN Catch-IRF4 (F6Y) fusion protein

Browse structure collections

About this viewer

MolViewer shows 2DLL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.