2DM1: Second SH3 domain of human protein vav-2

Solution structure of the second SH3 domain of human protein vav-2. Determined by solution NMR. Released 3 Apr 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 553
Mol. weight: 7.85 kDa
Released: 3 Apr 2007

Explore 2DM1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DM1 contains 0 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	9-12	4	1
β-strand	16	1	2
β-strand	23	1	3
β-strand	26	1	2
β-strand	31-33	3	1
β-strand	36	1	3
β-strand	45-49	5	3
β-strand	52-56	5	3
β-strand	61-63	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein vav-2	A	protein	73	Homo sapiens	P52735 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DM1_1 Protein vav-2 (chains A)
GSSGSSGGTAVARYNFAARDMRELSLREGDVVRIYSRIGGDQGWWKGETNGRIGWFPSTY
VEEEGIQSGPSSG

Primary citation

Solution structure of the second SH3 domain of human protein vav-2. Endo, H., Hayashi, F., Yoshida, M. et al. To be published.

Other PDB entries of the same protein (UniProt P52735 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ROJ 1.95 Å, Crystal Structure of the VAV2 SH2 domain in complex with TXNIP phosphorylated peptide
7RNV 2.15 Å, SH2 domain of guanine nucleotide exchange factor Vav2 in complex with an actin peptide…
7WFY 2.45 Å, Crystal Structure of the VAV2 SH2 domain in complex with APP phosphorylated peptide
2DLZ Solution structure of the SH2 domain of human protein vav-2
2LNW Identification and structural basis for a novel interaction between Vav2 and Arap3
2LNX Solution structure of Vav2 SH2 domain

Browse structure collections

About this viewer

MolViewer shows 2DM1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.