2DNY: PDB entry 2DNY

Solution structure of the third RNA binding domain of FBP-interacting repressor, SIAHBP1. Determined by solution NMR. Released 17 Apr 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 918
Mol. weight: 13.1 kDa
Released: 17 Apr 2007

Explore 2DNY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DNY contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	446-450	5	1
α-helix	460-470	11
β-strand	476-485	10	1
β-strand	494-502	9	1
α-helix	505-515	11
β-strand	519-520	2	2
β-strand	523-524	2	2
β-strand	526-529	4	1
α-helix	532-535	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fuse-binding protein-interacting repressor, isoform b	A	protein	119	Homo sapiens	Q9UHX1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DNY_1 Fuse-binding protein-interacting repressor, isoform b (chains A)
GSSGSSGKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEE
EDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSASGPSSG

Primary citation

Solution structure of the third RNA binding domain of FBP-interacting repressor, SIAHBP1. Suzuki, S., Nagata, T., Muto, Y. et al. To be published.

Other PDB entries of the same protein (UniProt Q9UHX1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UE2 1.23 Å, Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa…
3US5 1.38 Å, Crystal structure of a RNA-binding domain of a poly-U binding splicing factor 60KDa…
7Z3X 1.65 Å, Crystal structure of FIR RRM1-2 Y115F mutant bound to FUSE ssDNA
5KW6 1.91 Å, Two Tandem RRM Domains of PUF60 Bound to an AdML Pre-mRNA 3' Splice Site Analogue with a…
5KVY 1.95 Å, Crystal structure of the two tandem rrm domains of PUF60 bound to a portion of an adml…
6LUR 2.0 Å, Human PUF60 UHM domain (thioredoxin fusion) in complex with a small molecule binder
7Q8A 2.05 Å, Crystal structure of tandem domain RRM1-2 of FUBP-interacting repressor (FIR) bound to…
2QFJ 2.1 Å, Crystal Structure of First Two RRM Domains of FIR Bound to ssDNA from a Portion of FUSE
5KW1 2.1 Å, Crystal Structure of the Two Tandem RRM Domains of PUF60 Bound to a Modified AdML…
3DXB 2.2 Å, Structure of the UHM domain of Puf60 fused to thioredoxin
3UWT 2.5 Å, Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa…
5KWQ 2.8 Å, Two Tandem RRM Domains of FBP-Interacting Repressor (FIR), also Known as PUF60

Browse structure collections

About this viewer

MolViewer shows 2DNY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.