Solution structure of the RNA binding domain of squamous cell carcinoma antigen recognized by T cells 3. Determined by solution NMR. Released 17 Apr 2007.
Explore 2DO4 in 3D Show helices and sheets RCSB PDB PDBe
2DO4 contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 797-799 | 3 | |
| β-strand | 803-806 | 4 | 1 |
| α-helix | 814-821 | 8 | |
| β-strand | 827-834 | 8 | 1 |
| β-strand | 840-848 | 9 | 1 |
| α-helix | 851-861 | 11 | |
| β-strand | 864-865 | 2 | 2 |
| β-strand | 870-871 | 2 | 2 |
| β-strand | 872-875 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Squamous cell carcinoma antigen recognized by T-cells 3 | A | protein | 100 | Homo sapiens | Q15020 (AlphaFold model) |
>2DO4_1 Squamous cell carcinoma antigen recognized by T-cells 3 (chains A) GSSGSSGVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGL AYVEYENESQASQAVMKMDGMTIKENIIKVAISNSGPSSG
Solution structure of the RNA binding domain of squamous cell carcinoma antigen recognized by T cells 3. Suzuki, S., Muto, Y., Inoue, M. et al. To be published.
Other PDB entries of the same protein (UniProt Q15020 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2DO4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.