Crystal structure of human SART3/TIP110 half-a TPR (HAT) domain. Determined by X-ray diffraction at 2.6 Å resolution. Released 27 Apr 2016.
Explore 5CTQ in 3D Show helices and sheets RCSB PDB PDBe
5CTQ contains 125 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 95-107 | 13 | |
| α-helix | 112-125 | 14 | |
| α-helix | 128-141 | 14 | |
| α-helix | 143-145 | 3 | |
| α-helix | 146-159 | 14 | |
| α-helix | 163-179 | 17 | |
| α-helix | 183-193 | 11 | |
| α-helix | 194-196 | 3 | |
| α-helix | 202-217 | 16 | |
| α-helix | 225-238 | 14 | |
| α-helix | 244-255 | 12 | |
| α-helix | 262-272 | 11 | |
| α-helix | 279-304 | 26 | |
| α-helix | 310-323 | 14 | |
| α-helix | 326-339 | 14 | |
| α-helix | 344-353 | 10 | |
| α-helix | 354-358 | 5 | |
| α-helix | 361-374 | 14 | |
| α-helix | 379-391 | 13 | |
| α-helix | 396-409 | 14 | |
| α-helix | 414-429 | 16 | |
| α-helix | 440-455 | 16 | |
| α-helix | 456-460 | 5 | |
| α-helix | 461-464 | 4 | |
| α-helix | 473-484 | 12 | |
| α-helix | 489-501 | 13 | |
| α-helix | 508-521 | 14 | |
| α-helix | 524-537 | 14 | |
| α-helix | 542-556 | 15 | |
| α-helix | 559-603 | 45 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 95-107 | 13 | |
| α-helix | 112-125 | 14 | |
| α-helix | 128-139 | 12 | |
| α-helix | 143-145 | 3 | |
| α-helix | 146-158 | 13 | |
| α-helix | 166-176 | 11 | |
| α-helix | 183-193 | 11 | |
| α-helix | 194-196 | 3 | |
| α-helix | 202-217 | 16 | |
| α-helix | 225-238 | 14 | |
| α-helix | 244-255 | 12 | |
| α-helix | 263-272 | 10 | |
| α-helix | 276-278 | 3 | |
| α-helix | 279-304 | 26 | |
| α-helix | 306 | 1 | |
| α-helix | 310-323 | 14 | |
| α-helix | 326-339 | 14 | |
| α-helix | 344-353 | 10 | |
| α-helix | 354-358 | 5 | |
| α-helix | 361-374 | 14 | |
| α-helix | 379-391 | 13 | |
| α-helix | 396-407 | 12 | |
| α-helix | 414-429 | 16 | |
| α-helix | 440-455 | 16 | |
| α-helix | 456-460 | 5 | |
| α-helix | 461-464 | 4 | |
| α-helix | 473-484 | 12 | |
| α-helix | 489-499 | 11 | |
| α-helix | 500-504 | 5 | |
| α-helix | 508-521 | 14 | |
| α-helix | 524-537 | 14 | |
| α-helix | 542-556 | 15 | |
| α-helix | 559-582 | 24 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 95-107 | 13 | |
| α-helix | 112-125 | 14 | |
| α-helix | 128-139 | 12 | |
| α-helix | 143-145 | 3 | |
| α-helix | 146-159 | 14 | |
| α-helix | 164-179 | 16 | |
| α-helix | 183-194 | 12 | |
| α-helix | 202-217 | 16 | |
| α-helix | 225-237 | 13 | |
| α-helix | 244-254 | 11 | |
| α-helix | 262-272 | 11 | |
| α-helix | 276-278 | 3 | |
| α-helix | 279-304 | 26 | |
| α-helix | 306 | 1 | |
| α-helix | 310-323 | 14 | |
| α-helix | 326-339 | 14 | |
| α-helix | 344-353 | 10 | |
| α-helix | 354-358 | 5 | |
| α-helix | 361-374 | 14 | |
| α-helix | 379-391 | 13 | |
| α-helix | 396-407 | 12 | |
| α-helix | 414-429 | 16 | |
| α-helix | 440-455 | 16 | |
| α-helix | 456-460 | 5 | |
| α-helix | 461-464 | 4 | |
| α-helix | 473-484 | 12 | |
| α-helix | 489-499 | 11 | |
| α-helix | 500-504 | 5 | |
| α-helix | 508-521 | 14 | |
| α-helix | 524-537 | 14 | |
| α-helix | 542-556 | 15 | |
| α-helix | 559-587 | 29 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 95-107 | 13 | |
| α-helix | 112-125 | 14 | |
| α-helix | 128-139 | 12 | |
| α-helix | 143-145 | 3 | |
| α-helix | 146-159 | 14 | |
| α-helix | 163-179 | 17 | |
| α-helix | 183-193 | 11 | |
| α-helix | 194-196 | 3 | |
| α-helix | 202-217 | 16 | |
| α-helix | 224-237 | 14 | |
| α-helix | 244-255 | 12 | |
| α-helix | 263-272 | 10 | |
| α-helix | 279-304 | 26 | |
| α-helix | 310-323 | 14 | |
| α-helix | 326-339 | 14 | |
| α-helix | 344-353 | 10 | |
| α-helix | 354-358 | 5 | |
| α-helix | 361-374 | 14 | |
| α-helix | 379-391 | 13 | |
| α-helix | 396-407 | 12 | |
| α-helix | 414-429 | 16 | |
| α-helix | 440-455 | 16 | |
| α-helix | 456-460 | 5 | |
| α-helix | 461-464 | 4 | |
| α-helix | 473-484 | 12 | |
| α-helix | 489-501 | 13 | |
| α-helix | 508-521 | 14 | |
| α-helix | 524-537 | 14 | |
| α-helix | 542-555 | 14 | |
| α-helix | 559-594 | 36 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Squamous cell carcinoma antigen recognized by T-cells 3 | A, B, C, D | protein | 561 | Homo sapiens | Q15020 (AlphaFold model) |
>5CTQ_1 Squamous cell carcinoma antigen recognized by T-cells 3 (chains A, B, C, D) MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFENLYFQGNQLEIERLEEQLSINVY DYNCHVDLIRLLRLEGELTKVRMARQKMSEIFPLTEELWLEWLHDEISMAQDGLDREHVY DLFEKAVKDYICPNIWLEYGQYSVGGIGQKGGLEKVRSVFERALSSVGLHMTKGLALWEA YREFESAIVEAARLEKVHSLFRRQLAIPLYDMEATFAEYEEWSEDPIPESVIQNYNKALQ QLEKYKPYEEALLQAEAPRLAEYQAYIDFEMKIGDPARIQLIFERALVENCLVPDLWIRY SQYLDRQLKVKDLVLSVHNRAIRNCPWTVALWSRYLLAMERHGVDHQVISVTFEKALNAG FIQATDYVEIWQAYLDYLRRRVDFKQDSSKELEELRAAFTRALEYLKQEVEERFNESGDP SCVIMQNWARIEARLCNNMQKARELWDSIMTRGNAKYANMWLEYYNLERAHGDTQHCRKA LHRAVQCTSDYPEHVCEVLLTMERTEGSLEDWDIAVQKTETRLARVNEQRMKAAEKEAAL VQQEEEKAEQRKRARAEKKAL
Structural basis for recruiting and shuttling of the spliceosomal deubiquitinase USP4 by SART3. Park, J.K., Das, T., Song, E.J. et al. Nucleic Acids Res (2016) 44:5424-5437. DOI 10.1093/nar/gkw218 · PubMed
Other PDB entries of the same protein (UniProt Q15020 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5CTQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.