5JJX: HAT domain of sart3

Crystal structure of the HAT domain of sart3. Determined by X-ray diffraction at 2.0 Å resolution. Released 4 May 2016.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,549
Mol. weight: 37.25 kDa
Released: 4 May 2016

Explore 5JJX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JJX contains 18 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 0 β-strands

Element	Residues	Length
α-helix	91-107	17
α-helix	112-124	13
α-helix	128-141	14
α-helix	146-159	14
α-helix	163-176	14
α-helix	183-195	13
α-helix	202-217	16
α-helix	225-236	12
α-helix	245-255	11
α-helix	262-272	11
α-helix	276-278	3
α-helix	279-304	26
α-helix	306	1
α-helix	310-323	14
α-helix	326-339	14
α-helix	344-354	11
α-helix	361-374	14
α-helix	379-392	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Squamous cell carcinoma antigen recognized by T-cells 3	A	protein	314	Homo sapiens	Q15020 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5JJX_1 Squamous cell carcinoma antigen recognized by T-cells 3 (chains A)
GGEYEWEYDEEEEKNQLEIERLEEQLSINVYDYNCHVDLIRLLRLEGELTKVRMARQKMS
EIFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDYICPNIWLEYGQYSVGGIGQ
KGGLEKVRSVFERALSSVGLHMTKGLALWEAYREFESAIVEAARLEKVHSLFRRQLAIPL
YDMEATFAEYEEWSEDPIPESVIQNYNKALQQLEKYKPYEEALLQAEAPRLAEYQAYIDF
EMKIGDPARIQLIFERALVENCLVPDLWIRYSQYLDRQLKVKDLVLSVHNRAIRNCPWTV
ALWSRYLLAMERHG

Primary citation

Crystal structure of the HAT domain of sart3. ZHANG, Q., DONG, A., TEMPEL, W. et al. To be published.

Other PDB entries of the same protein (UniProt Q15020 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CTT 1.7 Å, Crystal structure of human SART3/TIP110 NLS-mouse importin alpha complex
5CTQ 2.6 Å, Crystal structure of human SART3/TIP110 half-a TPR (HAT) domain
5JJW 3.01 Å, Crystal structure of the HAT domain of sart3 in complex with USP15 DUSP-UBL domain
5CTR 3.01 Å, Crystal structure of human SART3 HAT-C domain-human USP4 DUSP-UBL domain complex
5JPZ 3.04 Å, Crystal structure of HAT domain of human Squamous Cell Carcinoma Antigen Recognized By T…
2DO4 Solution structure of the RNA binding domain of squamous cell carcinoma antigen…
7XX8 Solution structure of RRM1 of Human SART3
7XX9 Solution structure of RRM2 of Human SART3

Browse structure collections

About this viewer

MolViewer shows 5JJX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.