Solution structure of RRM1 of Human SART3. Determined by solution NMR. Released 30 Aug 2023.
Explore 7XX8 in 3D Show helices and sheets RCSB PDB PDBe
7XX8 contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 699-702 | 4 | |
| β-strand | 705-709 | 5 | 1 |
| α-helix | 718-721 | 4 | |
| α-helix | 723-726 | 4 | |
| β-strand | 732-737 | 6 | 1 |
| β-strand | 749-753 | 5 | 1 |
| α-helix | 756-764 | 9 | |
| β-strand | 769-770 | 2 | 2 |
| β-strand | 773-774 | 2 | 2 |
| β-strand | 776-779 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Squamous cell carcinoma antigen recognized by T-cells 3 | A | protein | 94 | Homo sapiens | Q15020 (AlphaFold model) |
>7XX8_1 Squamous cell carcinoma antigen recognized by T-cells 3 (chains A) GSHMHDSSKDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVE FKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKN
Structural investigation of human U6 snRNA recognition by spliceosomal recycling factor SART3 RNA recognition motifs. Kim, I., Bang, K.M., An, S.Y. et al. FEBS J (2025). DOI 10.1111/febs.70275 · PubMed
Other PDB entries of the same protein (UniProt Q15020 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7XX8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.