2DWV: Salvador homolog 1 protein

Solution structure of the second WW domain from mouse salvador homolog 1 protein (mWW45). Determined by solution NMR. Released 17 Feb 2007.

Method: Solution NMR
Organism: Mus musculus
Chains: 2
Atoms: 748
Mol. weight: 10.6 kDa
Released: 17 Feb 2007

Explore 2DWV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DWV contains 3 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	13-15	3
β-strand	18-23	6	1
β-strand	27-32	6	1
β-strand	37-39	3	1
α-helix	42-43	2

Chain B: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	16	1	1
β-strand	18-22	5	1
β-strand	28-32	5	1
β-strand	37-39	3	1
α-helix	42-43	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Salvador homolog 1 protein	A, B	protein	49	Mus musculus	Q8VEB2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2DWV_1 Salvador homolog 1 protein (chains A, B)
GSSGSSGPLEREGLPPGWERVESSEFGTYYVDHTNKRAQYRHPSGPSSG

Primary citation

Solution structure of an atypical WW domain in a novel beta-clam-like dimeric form. Ohnishi, S., Guntert, P., Koshiba, S. et al. FEBS Lett (2007) 581:462-468. DOI 10.1016/j.febslet.2007.01.008 · PubMed

Other PDB entries of the same protein (UniProt Q8VEB2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BQG 1.55 Å, Complex structure of SAV1 and Dendrin
7BQF 1.7 Å, Dimerization of SAV1 WW tandem
2YSB Solution structure of the first WW domain from the mouse salvador homolog 1 protein (SAV1)

Browse structure collections

About this viewer

MolViewer shows 2DWV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.