7BQF: Dimerization of SAV1 WW tandem

Dimerization of SAV1 WW tandem. Determined by X-ray diffraction at 1.7 Å resolution. Released 23 Sept 2020.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Mus musculus
Chains: 1
Atoms: 766
Mol. weight: 10.84 kDa
Ligands: DIO
Released: 23 Sept 2020

Explore 7BQF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7BQF contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	200-203	4
β-strand	206-210	5	1
β-strand	216-220	5	1
β-strand	225-227	3	1
α-helix	237-238	2
β-strand	241-244	4	2
β-strand	252-255	4	2
β-strand	260-262	3	2
α-helix	272-274	3
α-helix	276-281	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein salvador homolog 1	A	protein	92	Mus musculus	Q8VEB2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7BQF_1 Protein salvador homolog 1 (chains A)
GPGSEDLPLPPGWSVDWTMRGRKYYIDHNTNTTHWSHPLEREGLPPGWERVESSEFGTYY
VDHTNKRAQYRHPCAPSVPRYDQPPPITYQPQ

Ligands and cofactors

ID	Name	Formula	Copies
DIO	1,4-diethylene dioxide	C4 H8 O2	1

Primary citation

A WW Tandem-Mediated Dimerization Mode of SAV1 Essential for Hippo Signaling. Lin, Z., Xie, R., Guan, K. et al. Cell Rep (2020) 32:108118-108118. DOI 10.1016/j.celrep.2020.108118 · PubMed

Other PDB entries of the same protein (UniProt Q8VEB2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BQG 1.55 Å, Complex structure of SAV1 and Dendrin
2DWV Solution structure of the second WW domain from mouse salvador homolog 1 protein (mWW45)
2YSB Solution structure of the first WW domain from the mouse salvador homolog 1 protein (SAV1)

Browse structure collections

About this viewer

MolViewer shows 7BQF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.