Solution structure of the first WW domain from the mouse salvador homolog 1 protein (SAV1). Determined by solution NMR. Released 9 Oct 2007.
Explore 2YSB in 3D Show helices and sheets RCSB PDB PDBe
2YSB contains 0 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 16-20 | 5 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 35-37 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Salvador homolog 1 protein | A | protein | 49 | Mus musculus | Q8VEB2 (AlphaFold model) |
>2YSB_1 Salvador homolog 1 protein (chains A) GSSGSSGEDLPLPPGWSVDWTMRGRKYYIDHNTNTTHWSHPLESGPSSG
Solution structure of the first WW domain from the mouse salvador homolog 1 protein (SAV1). Ohnishi, S., Sato, M., Koshiba, S. et al. To be published.
Other PDB entries of the same protein (UniProt Q8VEB2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2YSB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.