8PXW: WW domain tandem of PRPF40A

Structure of the WW domain tandem of PRPF40A. Determined by solution NMR. Released 3 Apr 2024.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 806
Mol. weight: 11.45 kDa
Released: 3 Apr 2024

Explore 8PXW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8PXW contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	146-150	5	1
β-strand	156-160	5	1
β-strand	166-167	2	1
α-helix	172-174	3
α-helix	177-184	8
β-strand	187-191	5	2
β-strand	197-201	5	2
β-strand	207-208	2	2
α-helix	213-225	13
α-helix	230-232	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pre-mRNA-processing factor 40 homolog A	A	protein	99	Homo sapiens	O75400 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8PXW_1 Pre-mRNA-processing factor 40 homolog A (chains A)
GAMGAKSMWTEHKSPDGRTYYYNTETKQSTWEKPDDLKTPAEQLLSKCPWKEYKSDSGKP
YYYNSQTKESRWAKPKELEDLEGYQNTIVAGSLITKSNL

Primary citation

Intramolecular autoinhibition regulates the selectivity of PRPF40A tandem WW domains for proline-rich motifs. Martinez-Lumbreras, S., Trager, L.K., Mulorz, M.M. et al. Nat Commun (2024) 15:3888-3888. DOI 10.1038/s41467-024-48004-x · PubMed

Other PDB entries of the same protein (UniProt O75400 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UZC The structure of an ff domain from human HYPA/FBP11
1YWI Structure of the FBP11WW1 domain complexed to the peptide APPTPPPLPP
1YWJ Structure of the FBP11WW1 domain
1ZR7 Solution structure of the first WW domain of FBP11
2CQN Solution structure of the FF domain of human Formin-binding protein 3
2DYF Solution structure of the first WW domain of FBP11 / HYPA (FBP11 WW1) complexed with a…
2KZG A Transient and Low Populated Protein Folding Intermediate at Atomic Resolution
2L5F Solution structure of the tandem WW domains from HYPA/FBP11
2L9V NMR structure of the FF domain L24A mutant's folding transition state
2LKS Ff11-60
8PXX Structure of the WW domain tandem of PRPF40A in complex with SF1

Browse structure collections

About this viewer

MolViewer shows 8PXW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.