2LKS: Ff11-60

Ff11-60. Determined by solution NMR. Released 11 Jan 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 355
Mol. weight: 5.78 kDa
Released: 11 Jan 2012

Explore 2LKS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LKS contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	14-27	14
α-helix	36-45	10
α-helix	47-54	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pre-mRNA-processing factor 40 homolog A	A	protein	50	Homo sapiens	O75400 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LKS_1 Pre-mRNA-processing factor 40 homolog A (chains A)
GNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQ

Primary citation

Cross-Validation of the Structure of a Transiently Formed and Low Populated FF Domain Folding Intermediate Determined by Relaxation Dispersion NMR and CS-Rosetta. Barette, J., Velyvis, A., Religa, T.L. et al. J Phys Chem B (2012) 116:6637-6644. DOI 10.1021/jp209974f · PubMed

Other PDB entries of the same protein (UniProt O75400 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UZC The structure of an ff domain from human HYPA/FBP11
1YWI Structure of the FBP11WW1 domain complexed to the peptide APPTPPPLPP
1YWJ Structure of the FBP11WW1 domain
1ZR7 Solution structure of the first WW domain of FBP11
2CQN Solution structure of the FF domain of human Formin-binding protein 3
2DYF Solution structure of the first WW domain of FBP11 / HYPA (FBP11 WW1) complexed with a…
2KZG A Transient and Low Populated Protein Folding Intermediate at Atomic Resolution
2L5F Solution structure of the tandem WW domains from HYPA/FBP11
2L9V NMR structure of the FF domain L24A mutant's folding transition state
8PXW Structure of the WW domain tandem of PRPF40A
8PXX Structure of the WW domain tandem of PRPF40A in complex with SF1

Browse structure collections

About this viewer

MolViewer shows 2LKS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.