2EBW: BRCT domain from human DNA repair protein REV1

Solution structure of the BRCT domain from human DNA repair protein REV1. Determined by solution NMR. Released 14 Aug 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 759
Mol. weight: 10.78 kDa
Released: 14 Aug 2007

Explore 2EBW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EBW contains 4 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	53-56	4	1
α-helix	64-73	10
β-strand	77-78	2	1
β-strand	89-91	3	1
α-helix	99-102	4
β-strand	109	1	2
α-helix	112-120	9
α-helix	127-129	3
β-strand	130	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA repair protein REV1	A	protein	97	Homo sapiens	Q9UBZ9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2EBW_1 DNA repair protein REV1 (chains A)
GSSGSSGTSSTIFSGVAIYVNGYTDPSAEELRKLMMLHGGQYHVYYSRSKTTHIIATNLP
NAKIKELKGEKVIRPEWIVESIKAGRLLSYIPYQLYT

Primary citation

Solution structure of the BRCT domain from human DNA repair protein REV1. Nagashima, T., Hayashi, F., Yokoyama, S. To be published.

Other PDB entries of the same protein (UniProt Q9UBZ9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4EXT 1.9 Å, Structure of polymerase-interacting domain of human Rev1 in complex with translesional…
6WS0 2.24 Å, Rational drug design of phenazopyridine derivatives as novel inhibitors of Rev1-CT
6ASR 2.36 Å, REV1 UBM2 domain complex with ubiquitin
6WS5 2.47 Å, Rational drug design of phenazopyridine derivatives as novel inhibitors of Rev1-CT
3GQC 2.5 Å, Structure of human Rev1-DNA-dNTP ternary complex
4GK0 2.7 Å, Crystal structure of human Rev3-Rev7-Rev1 complex
9VGW 2.7 Å, Crystal structure of human PCNA in complex with REV1 PIP-box
4BA9 2.73 Å, The structural basis for the coordination of Y-family Translesion DNA Polymerases by Rev1
3VU7 2.8 Å, Crystal structure of REV1-REV7-REV3 ternary complex
4GK5 3.21 Å, Crystal structure of human Rev3-Rev7-Rev1-Polkappa complex
2LSI Solution structure of polymerase-interacting domain of human Rev1 in complex with…
2LSK C-terminal domain of human REV1 in complex with DNA-polymerase H (eta)

Browse structure collections

About this viewer

MolViewer shows 2EBW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.