4GK0: Human Rev3-Rev7-Rev1 complex

Crystal structure of human Rev3-Rev7-Rev1 complex. Determined by X-ray diffraction at 2.7 Å resolution. Released 13 Mar 2013.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 6
Atoms: 4,987
Mol. weight: 95.54 kDa
Released: 13 Mar 2013

Explore 4GK0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GK0 contains 29 α-helices and 24 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	13-33	21
α-helix	39-41	3
β-strand	42-47	6	1
β-strand	50-55	6	1
α-helix	58-76	19
β-strand	80-88	9	2
β-strand	94-103	10	2
α-helix	112-114	3
α-helix	119-131	13
α-helix	133-135	3
α-helix	138-141	4
β-strand	145-152	8	2
α-helix	157-163	7
β-strand	171-173	3	2
β-strand	184-193	10	2
β-strand	198-206	9	2

Chain B: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	11-33	23
α-helix	39-41	3
β-strand	42-47	6	3
β-strand	50-55	6	3
α-helix	58-76	19
β-strand	80-88	9	4
β-strand	94-102	9	4
α-helix	118-131	14
α-helix	133-135	3
α-helix	138-141	4
β-strand	145-152	8	4
α-helix	157-163	7
β-strand	171-173	3	4
α-helix	176-179	4
β-strand	184-193	10	4
β-strand	198-206	9	4

Chain C: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1877-1880	4	2
α-helix	1883-1885	3
α-helix	1888-1891	4

Chain D: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1877-1880	4	4
α-helix	1883-1884	2
α-helix	1887-1890	4

Chain E: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	1159	1	5
β-strand	1162	1	5
α-helix	1165-1178	14
α-helix	1184-1199	16
α-helix	1203-1219	17
α-helix	1223-1243	21
β-strand	1247-1248	2	2

Chain F: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	1159	1	6
β-strand	1162	1	6
α-helix	1165-1177	13
α-helix	1184-1199	16
α-helix	1203-1217	15
α-helix	1224-1243	20
β-strand	1247-1248	2	4
α-helix	1249	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitotic spindle assembly checkpoint protein MAD2B	A, B	protein	238	Homo sapiens	Q9UI95 (AlphaFold model)
DNA polymerase zeta catalytic subunit	C, D	protein	52	Homo sapiens	O60673
DNA repair protein REV1	E, F	protein	136	Homo sapiens	Q9UBZ9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4GK0_1 Mitotic spindle assembly checkpoint protein MAD2B (chains A, B)
MGSSHHHHHHSQDPNSMTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQK
RKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQ
PPLLSISSDSLLSHVEQLLAAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQ
VIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGSGSGSGSGSGSH

Sequence of entity 2 (C, D), FASTA

>4GK0_2 DNA polymerase zeta catalytic subunit (chains C, D)
MLTPTPDSSPRSTSSPSQSKNGSFTPRTANILKPLMSPPSREEIMATLLDHD

Sequence of entity 3 (E, F), FASTA

>4GK0_3 DNA repair protein REV1 (chains E, F)
MLKHEGPPAEKPLEELSASTSGVPGLSSLQSDPAGCVRPPAPNLAGAVEFNDVKTLLREW
ITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDN
VQVVLQQTYGSTLKVT

Primary citation

Structural insights into the assembly of human translesion polymerase complexes. Xie, W., Yang, X., Xu, M. et al. Protein Cell (2012) 3:864-874. DOI 10.1007/s13238-012-2102-x · PubMed

Other PDB entries of the same protein (UniProt Q9UI95 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BCD 1.43 Å, Crystal structure of Rev7-K44A/R124A/A135D in complex with Rev3-RBM2 (residues 1988-2014)
6BC8 1.68 Å, Crystal structure of Rev7-R124A/Rev3-RBM2 (residues 1988-2014) complex
6M7B 1.77 Å, Structure of REV7-R124A complexed with SHLD3(37-73)
3ABD 1.9 Å, Structure of human REV7 in complex with a human REV3 fragment in a monoclinic crystal
4EXT 1.9 Å, Structure of polymerase-interacting domain of human Rev1 in complex with translesional…
6M7A 1.9 Å, Structure of REV7-R124A complexed with SHLD3(28-73)
6VE5 2.0 Å, X-ray structure of human REV7 in complex with Shieldin3 (residues 41-74)
6NIF 2.0 Å, crystal structure of human REV7-RAN complex
5XPT 2.1 Å, Crystal structure of MAD2L2/REV7 in complex with a CAMP fragment in a tetragonal crystal
6K07 2.24 Å, Crystal structure of REV7(R124A) in complex with a Shieldin3 fragment
6WS0 2.24 Å, Rational drug design of phenazopyridine derivatives as novel inhibitors of Rev1-CT
5XPU 2.3 Å, Crystal structure of MAD2L2/REV7 in complex with a CAMP fragment in a monoclinic crystal

Browse structure collections

About this viewer

MolViewer shows 4GK0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.