2LSI: Polymerase-interacting domain of human Rev1

Solution structure of polymerase-interacting domain of human Rev1 in complex with translesional synthesis polymerase kappa. Determined by solution NMR. Released 29 May 2013.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 954
Mol. weight: 13.61 kDa
Released: 29 May 2013

Explore 2LSI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LSI contains 5 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	1159	1	1
β-strand	1162	1	1
α-helix	1165-1178	14
α-helix	1184-1199	16
α-helix	1203-1219	17
α-helix	1223-1243	21

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	567-574	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA repair protein REV1	A	protein	99	Homo sapiens	Q9UBZ9 (AlphaFold model)
DNA polymerase kappa	B	protein	17	Homo sapiens	Q9UBT6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LSI_1 DNA repair protein REV1 (chains A)
GHMAPNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKY
MKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT

Sequence of entity 2 (B), FASTA

>2LSI_2 DNA polymerase kappa (chains B)
GSHKKSFFDKKRSERKW

Primary citation

Insights into the scaffold mechanism of human Rev1 in translesional synthesis revealed by the structural studies on its polymerase-interacting domain. Liu, D., Ryu, K., Ko, J. et al. To be published.

Other PDB entries of the same protein (UniProt Q9UBZ9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4EXT 1.9 Å, Structure of polymerase-interacting domain of human Rev1 in complex with translesional…
6WS0 2.24 Å, Rational drug design of phenazopyridine derivatives as novel inhibitors of Rev1-CT
6ASR 2.36 Å, REV1 UBM2 domain complex with ubiquitin
6WS5 2.47 Å, Rational drug design of phenazopyridine derivatives as novel inhibitors of Rev1-CT
3GQC 2.5 Å, Structure of human Rev1-DNA-dNTP ternary complex
4GK0 2.7 Å, Crystal structure of human Rev3-Rev7-Rev1 complex
9VGW 2.7 Å, Crystal structure of human PCNA in complex with REV1 PIP-box
4BA9 2.73 Å, The structural basis for the coordination of Y-family Translesion DNA Polymerases by Rev1
3VU7 2.8 Å, Crystal structure of REV1-REV7-REV3 ternary complex
4GK5 3.21 Å, Crystal structure of human Rev3-Rev7-Rev1-Polkappa complex
2EBW Solution structure of the BRCT domain from human DNA repair protein REV1
2LSK C-terminal domain of human REV1 in complex with DNA-polymerase H (eta)

Browse structure collections

About this viewer

MolViewer shows 2LSI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.