2EIQ: Thioredoxin 1

Design of Disulfide-linked Thioredoxin Dimers and Multimers Through Analysis of Crystal Contacts. Determined by X-ray diffraction at 1.9 Å resolution. Released 11 Sept 2007.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Escherichia coli
Chains: 2
Atoms: 1,767
Mol. weight: 23.74 kDa
Ligands: CU
Released: 11 Sept 2007

Explore 2EIQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EIQ contains 10 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
α-helix	7	1
α-helix	9-11	3
β-strand	12	1	2
β-strand	17	1	2
β-strand	22-28	7	1
α-helix	33-48	16
β-strand	54-59	6	1
α-helix	66-69	4
β-strand	77-82	6	1
β-strand	85-91	7	1
α-helix	96-106	11

Chain B: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	3
α-helix	12	1
α-helix	13-17	5
β-strand	23-28	6	3
α-helix	33-48	16
β-strand	54-59	6	3
α-helix	66-69	4
β-strand	77-82	6	3
β-strand	85-91	7	3
α-helix	96-106	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thioredoxin 1	A, B	protein	108	Escherichia coli	P0AA25 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2EIQ_1 Thioredoxin 1 (chains A, B)
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNI
DQNPGTAPKYGIRGIPTLLLFKNGEVAACKVGALSKGQLKEFLDANLA

Ligands and cofactors

ID	Name	Formula	Copies
CU	Copper (II) ion	Cu	2

Water and common crystallization additives (MPD) are not listed.

Primary citation

Design of Disulfide-linked Thioredoxin Dimers and Multimers Through Analysis of Crystal Contacts. Das, M., Kobayashi, M., Yamada, Y. et al. J Mol Biol (2007) 372:1278-1292. DOI 10.1016/j.jmb.2007.07.033 · PubMed

Other PDB entries of the same protein (UniProt P0AA25 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HUA 1.1 Å, E. coli thioredoxin variant with (4R)-FluoroPro76 as single proline residue
5HR3 1.1 Å, Crystal structure of thioredoxin N106A mutant
5HR2 1.2 Å, Crystal structure of thioredoxin L94A mutant
5HR0 1.31 Å, Crystal structure of thioredoxin E101G mutant
4HU7 1.4 Å, E. coli thioredoxin variant with Pro76 as single proline residue
4HU9 1.55 Å, E. coli thioredoxin variant with (4S)-FluoroPro76 as single proline residue
4X43 1.65 Å, Structure of proline-free E. coli Thioredoxin
2TRX 1.68 Å, Crystal structure of thioredoxin from escherichia coli at 1.68 Å resolution
6Y4Y 1.75 Å, The crystal structure of human MACROD2 in space group P41212
1KEB 1.8 Å, Crystal Structure of Double Mutant M37L,P40S E.coli Thioredoxin
6Y4Z 1.9 Å, The crystal structure of human MACROD2 in space group P43212
6SLO 1.94 Å, Crystal structure of PUF60 UHM domain in complex with 7,8 dimethoxyperphenazine

Browse structure collections

About this viewer

MolViewer shows 2EIQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.