2ETX: MDC1 Tandem BRCT Domains

Crystal Structure of MDC1 Tandem BRCT Domains. Determined by X-ray diffraction at 1.33 Å resolution. Released 15 Nov 2005.

Method: X-ray diffraction
Resolution: 1.33 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,459
Mol. weight: 45.83 kDa
Released: 15 Nov 2005

Explore 2ETX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ETX contains 24 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	1894-1897	4	1
α-helix	1903-1911	9
β-strand	1915-1916	2	1
β-strand	1925-1927	3	1
α-helix	1935-1943	9
β-strand	1947-1948	2	1
α-helix	1951-1959	9
α-helix	1962-1964	3
α-helix	1966-1968	3
β-strand	1969	1	1
α-helix	1973-1978	6
α-helix	1983-1992	10
β-strand	2000-2003	4	2
α-helix	2011-2020	10
β-strand	2024-2025	2	2
β-strand	2037-2040	4	2
α-helix	2043-2048	6
α-helix	2050-2055	6
β-strand	2059-2060	2	2
α-helix	2063-2071	9
α-helix	2076-2079	4
β-strand	2080	1	2

Chain B: 12 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	1894-1898	5	3
α-helix	1903-1911	9
β-strand	1915-1916	2	3
β-strand	1925-1928	4	3
α-helix	1935-1943	9
β-strand	1947-1948	2	3
α-helix	1951-1959	9
α-helix	1962-1964	3
α-helix	1966-1968	3
β-strand	1969	1	3
α-helix	1973-1979	7
α-helix	1983-1992	10
β-strand	2000-2003	4	4
α-helix	2011-2020	10
β-strand	2024-2025	2	4
β-strand	2037-2040	4	4
α-helix	2043-2048	6
α-helix	2050-2055	6
β-strand	2059-2060	2	4
α-helix	2063-2071	9
α-helix	2076-2079	4
β-strand	2080	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mediator of DNA damage checkpoint protein 1	A, B	protein	209	Homo sapiens	Q14676 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2ETX_1 Mediator of DNA damage checkpoint protein 1 (chains A, B)
GHMTKLNQESTAPKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCA
LGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYE
IYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLL
SPEFLLTGVLKQEAKPEAFVLSPLEMSST

Primary citation

Molecular Basis for the Association of Microcephalin (MCPH1) Protein with the Cell Division Cycle Protein 27 (Cdc27) Subunit of the Anaphase-promoting Complex. Singh, N., Wiltshire, T.D., Thompson, J.R. et al. J Biol Chem (2012) 287:2854-2862. DOI 10.1074/jbc.M111.307868 · PubMed

Other PDB entries of the same protein (UniProt Q14676 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3K05 1.33 Å, The crystal structure of MDC1 BRCT T2067D in complex with a minimal recognition…
2ADO 1.45 Å, Crystal Structure Of The Brct Repeat Region From The Mediator of DNA damage checkpoint…
3UMZ 1.65 Å, Crystal Structure of the human MDC1 FHA Domain
3UNN 1.7 Å, Monomeric structure of the human MDC1 FHA domain in complex with an MDC1 phospho-T4…
3UNM 1.8 Å, Crystal Structure of The Human MDC1 FHA Domain
3UOT 1.8 Å, Crystal Structure of MDC1 FHA Domain in Complex with a Phosphorylated Peptide from the…
3UN0 2.3 Å, Crystal Structure of MDC1 FHA Domain
9QJZ 2.31 Å, Crystal structure of ARC4 from human Tankyrase 2 in complex with phosphorylated peptide…
2AZM 2.41 Å, Crystal structure of the MDC1 brct repeat in complex with the histone tail of gamma-H2AX
9IF9 2.55 Å, Crystal structure of the Pellino 1 FHA domain in complex with a MDC1-TQxF phosphopeptide.
3UEO 2.6 Å, Crystal structure of TopBP1 BRCT4/5 domains in complex with a phospho-peptide

Browse structure collections

About this viewer

MolViewer shows 2ETX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.