Epi-biotin complex with core streptavidin. Determined by X-ray diffraction at 0.85 Å resolution. Released 29 Nov 2005.
Explore 2F01 in 3D Show helices and sheets RCSB PDB PDBe
2F01 contains 4 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 19-23 | 5 | 1 |
| β-strand | 28-33 | 6 | 1 |
| β-strand | 38-44 | 7 | 1 |
| β-strand | 54-60 | 7 | 1 |
| α-helix | 69-70 | 2 | |
| β-strand | 71-80 | 10 | 1 |
| β-strand | 85-97 | 13 | 1 |
| β-strand | 103-112 | 10 | 1 |
| α-helix | 113 | 1 | |
| α-helix | 116-121 | 6 | |
| β-strand | 123-133 | 11 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 19-23 | 5 | 2 |
| β-strand | 28-33 | 6 | 2 |
| β-strand | 38-44 | 7 | 2 |
| β-strand | 54-60 | 7 | 2 |
| β-strand | 71-80 | 10 | 2 |
| β-strand | 85-97 | 13 | 2 |
| β-strand | 103-112 | 10 | 2 |
| α-helix | 116-121 | 6 | |
| β-strand | 123-131 | 9 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Streptavidin | A, B | protein | 127 | Streptomyces avidinii | P22629 (AlphaFold model) |
>2F01_1 Streptavidin (chains A, B) AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTA LGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTK VKPSAAS
Water and common crystallization additives (GOL) are not listed.
The high-resolution structure of (+)-epi-biotin bound to streptavidin. Le Trong, I., Aubert, D.G., Thomas, N.R. et al. Acta Crystallogr D Biol Crystallogr (2006) 62:576-581. DOI 10.1107/S0907444906011887 · PubMed
Other PDB entries of the same protein (UniProt P22629 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2F01 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.