2F9J: Pre-mRNA branch site protein p14

3.0 angstrom resolution structure of a Y22M mutant of the spliceosomal protein p14 bound to a region of SF3b155. Determined by X-ray diffraction at 3.0 Å resolution. Released 24 Jan 2006.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,428
Mol. weight: 37.97 kDa
Released: 24 Jan 2006

Explore 2F9J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2F9J contains 13 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	20-24	5	1
α-helix	32-40	9
β-strand	45-51	7	1
β-strand	60-64	5	1
α-helix	67-77	11
β-strand	81-82	2	2
β-strand	85-86	2	2
α-helix	87	1
β-strand	88-91	4	1
α-helix	94-97	4
α-helix	103-116	14

Chain B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	20-24	5	3
α-helix	32-40	9
β-strand	45-51	7	3
β-strand	60-64	5	3
α-helix	67-77	11
β-strand	81-82	2	4
β-strand	85-86	2	4
β-strand	88-91	4	3
α-helix	94-97	4
α-helix	103-116	14

Chain P: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	382-394	13
α-helix	401-405	5
β-strand	412-414	3	1

Chain Q: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	391-394	4
α-helix	401-405	5
β-strand	412-414	3	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pre-mRNA branch site protein p14	A, B	protein	125	Homo sapiens	Q9Y3B4 (AlphaFold model)
Splicing factor 3B subunit 1	P, Q	protein	36	Homo sapiens	O75533 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2F9J_1 Pre-mRNA branch site protein p14 (chains A, B)
MAMQAAKRANIRLPPEVNRILMIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTA
YVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGIN
TDPPK

Sequence of entity 2 (P, Q), FASTA

>2F9J_2 Splicing factor 3B subunit 1 (chains P, Q)
GEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVL

Primary citation

Crystal structure of a core spliceosomal protein interface. Schellenberg, M.J., Edwards, R.A., Ritchie, D.B. et al. Proc Natl Acad Sci U S A (2006) 103:1266-1271. DOI 10.1073/pnas.0508048103 · PubMed

Other PDB entries of the same protein (UniProt Q9Y3B4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Q4O 2.1 Å, Substrate-bound A-like U2 snRNP
3LQV 2.38 Å, Branch Recognition by SF3b14
2F9D 2.5 Å, 2.5 angstrom resolution structure of the spliceosomal protein p14 bound to region of…
8H6L 2.6 Å, Cryo-EM structure of human exon-defined spliceosome in the early B state.
8H6K 2.7 Å, Cryo-EM structure of human exon-defined spliceosome in the mature B state.
7DVQ 2.89 Å, Cryo-EM Structure of the Activated Human Minor Spliceosome (minor Bact Complex)
8I0R 3.0 Å, The cryo-EM structure of human Bact-I complex
8H6E 3.2 Å, Cryo-EM structure of human exon-defined spliceosome in the late pre-B state.
8H6J 3.25 Å, Cryo-EM structure of human exon-defined spliceosome in the mature pre-B state.
9ZE2 3.26 Å, Cryo-EM structure of the endogenous U2/branchpoint spliceosomal complex (core)
6FF4 3.4 Å, human Bact spliceosome core structure
8I0P 3.4 Å, The cryo-EM structure of human pre-Bact complex

Browse structure collections

About this viewer

MolViewer shows 2F9J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.